DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and dhrs13a.3

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001007425.2 Gene:dhrs13a.3 / 492783 ZFINID:ZDB-GENE-041114-134 Length:318 Species:Danio rerio


Alignment Length:292 Identity:95/292 - (32%)
Similarity:154/292 - (52%) Gaps:46/292 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LVHDAQYKARDRVALYKQPDRIAVITGGNRGIGLRIVEKLLACDMT-----VVMGVRDPKIAETA 107
            |...|:||....:     ..:.|::||.|.|||     |..|.|:.     |::..|:.:.||  
Zfish    22 LFKGARYKGNATL-----NGKTAIVTGSNTGIG-----KTTALDLARRGARVILACRNQERAE-- 74

  Fly   108 VASIVDLNATKG--KLICEQLDVGDLKSVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYE 170
             |::.|:....|  :::...||:..|:||:.||:...:...::|||:||||::.:  ..|.||:.
Zfish    75 -AAVYDIRKESGNSEVLYMHLDLASLQSVRDFAETFLKTEPRLDLLINNAGLIAS--GRTEDGFG 136

  Fly   171 SHFAINFLGHFLLTHLLLPQLRAAGKEGRNSRIVNVSSCVNLIGRINY------KD-INGTKHYY 228
            ..|.:|.|||||||.|||.:|    |:..|||:||||:.::.:|.:::      || :.|..:::
Zfish   137 MAFGVNHLGHFLLTLLLLDRL----KQSENSRVVNVSALLHRLGSLDFNLLNTQKDLVTGQSYWH 197

  Fly   229 PGTAYSQSKLAQILFTRHLQTLLDAEKSHVQVNVVHPGIVDTDLFEHSATTSVPIFK-------K 286
            ...||..|||..:||||.|...|  |.:.|....:|||::.|::..:..    |:.|       |
Zfish   198 AIKAYCHSKLCNVLFTRELANRL--EGTSVTCYCLHPGVISTEIGRYMG----PLQKLLCLPMSK 256

  Fly   287 LFFKTPERGSRTVVFAAIDPSIEGQGGTYLSN 318
            |||..||.|::|.::.|:...:|...|.|.|:
Zfish   257 LFFLDPEAGAQTTLYCALQEGLEPLSGRYFSS 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 91/284 (32%)
NADB_Rossmann 67..338 CDD:304358 91/273 (33%)
dhrs13a.3NP_001007425.2 SDR 36..311 CDD:330230 91/273 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.