DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and rdh14a

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001006031.1 Gene:rdh14a / 450010 ZFINID:ZDB-GENE-041010-124 Length:286 Species:Danio rerio


Alignment Length:285 Identity:103/285 - (36%)
Similarity:153/285 - (53%) Gaps:31/285 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASI-VDLNATKGKLICEQLDVGDL 131
            :..::||.|.|||.....:||.....|:|..||.:.||.|...| .:....:|:|:.:.||:..|
Zfish     5 KTVIVTGANSGIGKATTTELLRRQARVIMACRDRERAEKAAQEIKQEAGPEQGELVIKLLDLASL 69

  Fly   132 KSVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGK 196
            |||:.|.:.|.:...::|:|:|||||...|:..:.||:|..||:|.|||||||:|||..|:.:..
Zfish    70 KSVRVFCEGIIKEEPRIDILINNAGIYQCPYTKSEDGFEMQFAVNHLGHFLLTNLLLDLLKCSAP 134

  Fly   197 EGRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTLLDAEKSHVQVN 261
                |||:.|||.:...|.||:.|:|..:.|....:|::||||.:|||..|...|  :::.|.||
Zfish   135 ----SRIIVVSSKLYKYGEINFDDLNSEQSYDKAFSYARSKLANLLFTLELSHKL--KETGVTVN 193

  Fly   262 VVHPGIVDTDLFEHSATTSVPIFKK--------LFFKTPERGSRTVVFAAIDPSIEGQGGTYLSN 318
            .:.||||.|:|..|   ..:|:..|        .|||:||.|::|.|:.|....:||.       
Zfish   194 ALTPGIVRTNLGRH---VHIPLLVKPLFNLASRAFFKSPEEGAQTSVYLACSEDVEGV------- 248

  Fly   319 GGKGPFHPDAKKPAKCEQLFQFSCD 343
              :|....|.|:    |||...:.|
Zfish   249 --QGKCFADCKE----EQLLAKATD 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 103/285 (36%)
NADB_Rossmann 67..338 CDD:304358 101/278 (36%)
rdh14aNP_001006031.1 PRK06197 4..285 CDD:235737 103/285 (36%)
NADB_Rossmann 4..278 CDD:304358 103/285 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.