DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and dhrs13l1

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_991211.1 Gene:dhrs13l1 / 402945 ZFINID:ZDB-GENE-040426-1907 Length:318 Species:Danio rerio


Alignment Length:285 Identity:90/285 - (31%)
Similarity:141/285 - (49%) Gaps:20/285 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVGDLK 132
            :..::||||.|||......|......|::..|..:..|.| |..:...:....:|..|||:...|
Zfish    36 KTVIVTGGNTGIGKATATALAVRGARVILACRSKQKGEEA-AKEIRTESGNDDVIFMQLDLASQK 99

  Fly   133 SVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGKE 197
            |:::||:...:...::|||:||||:  |....|.||......:|.:|.||||:|||.:|    ||
Zfish   100 SIRSFAETFLKTEPRLDLLINNAGL--AAAGRTEDGIGMILGVNHIGPFLLTNLLLERL----KE 158

  Fly   198 GRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGT-------AYSQSKLAQILFTRHLQTLLDAEK 255
            ...||:||||||.:.:|.|::..||..|....|:       ||:.|||..:|||..|...|  |.
Zfish   159 CAPSRVVNVSSCGHDLGTIDFDCINTHKKLGLGSSDGDLFRAYTHSKLCNVLFTHELAKRL--EG 221

  Fly   256 SHVQVNVVHPGIVDT----DLFEHSATTSVPIFKKLFFKTPERGSRTVVFAAIDPSIEGQGGTYL 316
            ::|....:|||.|.:    |:.|..|...:.:..|.|...|..|::|.::.::...||...|.|.
Zfish   222 TNVTCYSLHPGSVRSELGRDITEWHARVLLTVVSKFFATDPVSGAQTTLYCSLQDGIEHLSGRYF 286

  Fly   317 SNGGKGPFHPDAKKPAKCEQLFQFS 341
            |:........:|:.....::|::.|
Zfish   287 SDCQLVQVKAEARDDGVAKKLWEVS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 90/285 (32%)
NADB_Rossmann 67..338 CDD:304358 88/280 (31%)
dhrs13l1NP_991211.1 PRK06197 35..316 CDD:235737 90/285 (32%)
NADB_Rossmann 35..311 CDD:304358 89/283 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.