DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and wwox

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_957207.1 Gene:wwox / 393887 ZFINID:ZDB-GENE-040426-858 Length:412 Species:Danio rerio


Alignment Length:330 Identity:93/330 - (28%)
Similarity:156/330 - (47%) Gaps:31/330 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KSWFEWKTEFRYQYLGIVGLVHDAQYKARDRVALYKQPDRIAVITGGNRGIGLRIVEKLLACDMT 93
            |::|:.:..|..:.:.:....:|....|.:.:......|::.::||.|.|||.............
Zfish    83 KTYFDPRQAFTVEDMQVKPKRYDGNTGALEILHGQDLSDKVIIVTGANSGIGFETARSFALHGAH 147

  Fly    94 VVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVGDLKSVKAFAQLIKERYSKVDLLLNNAGIM 158
            |::..|:...|..| ||::....:|.::....||:..|:||:.||:|.|.....:.:|:.||.:.
Zfish   148 VILACRNQSRASKA-ASLIMGEWSKARVEVLPLDLASLRSVRQFAELFKATKLPLHVLVCNAAVC 211

  Fly   159 FAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGKEGRNSRIVNVS-----------SCVNL 212
            ..|::||.||:||.|.|..||||||..||...||.:..    :|:|.||           ||.||
Zfish   212 SQPWRLTEDGFESTFQICHLGHFLLVQLLQDVLRLSAP----ARVVVVSSESHRFTDLLDSCGNL 272

  Fly   213 IGRINYKDIN----GTKHYYPGTAYSQSKLAQILFTRHLQTLLDAEKSHVQVNVVHPGIVDTDLF 273
                   |::    ..|:|:...||:::||..:||:..|...:...  .:..|.:|||.:.....
Zfish   273 -------DLDLLSPPQKNYWSLLAYNRAKLCNLLFSSELHRRMSPH--GICCNALHPGSMMFTSI 328

  Fly   274 EHSATTSVPIFK--KLFFKTPERGSRTVVFAAIDPSIEGQGGTYLSNGGKGPFHPDAKKPAKCEQ 336
            ..|......:|.  :.|.|:.::|:.|.|:.|:.|.:||.||.|.:|..:....|.|:.||....
Zfish   329 HRSWWLLTLLFSLARPFTKSMQQGAATTVYCAVAPELEGIGGMYFNNCFRCLPSPQAQDPAAALS 393

  Fly   337 LFQFS 341
            |::.|
Zfish   394 LWELS 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 89/303 (29%)
NADB_Rossmann 67..338 CDD:304358 86/287 (30%)
wwoxNP_957207.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..24
WW 18..47 CDD:278809
Nuclear localization signal. /evidence=ECO:0000250 50..55
WW 59..88 CDD:278809 2/4 (50%)
PRK06196 108..402 CDD:235736 89/305 (29%)
human_WWOX_like_SDR_c-like 121..404 CDD:187669 88/292 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.