DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and C2orf81

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001303693.1 Gene:C2orf81 / 388963 HGNCID:34350 Length:615 Species:Homo sapiens


Alignment Length:205 Identity:49/205 - (23%)
Similarity:74/205 - (36%) Gaps:45/205 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   152 LNNAGIMFAPFKLTA------------DGY--ESHFAINFLGHFLLTHLLL-------PQLRAAG 195
            |::||.:.|.|:|:.            |.|  .|..|....||.|..||.|       |||.|||
Human   250 LSSAGSLSASFQLSVEEAPADDADPSLDPYLVASPQASTGRGHPLGFHLSLEDLYCCMPQLDAAG 314

  Fly   196 K--EGRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTLLDAEKSHV 258
            .  |.|:..:..::|.|    .::|..:.|...  |..:..|.:..      |....|.|....:
Human   315 DRLELRSEGVPCIASGV----LVSYPSVGGATR--PSASCQQQRAG------HSDVRLSAHHHRM 367

  Fly   259 Q----VNVVHPGIVDTDLFEHSATTSVPIFKKL---FFKTPERGSRTVVFAAIDPSIEGQGGTYL 316
            :    |..:.|..:........|...||..:..   .::..:||.:|.  |..:|...|. ||.:
Human   368 RRKAAVKRLDPARLPCHWVRPLAEVLVPDSQTRPLEAYRGRQRGEKTK--ARAEPQALGP-GTRV 429

  Fly   317 SNGGKGPFHP 326
            |.....|..|
Human   430 SPAAFFPLRP 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 49/205 (24%)
NADB_Rossmann 67..338 CDD:304358 49/205 (24%)
C2orf81NP_001303693.1 DUF4639 9..614 CDD:292118 49/205 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.