Sequence 1: | NP_001286630.1 | Gene: | CG11200 / 37301 | FlyBaseID: | FBgn0034500 | Length: | 355 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001303693.1 | Gene: | C2orf81 / 388963 | HGNCID: | 34350 | Length: | 615 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 49/205 - (23%) |
---|---|---|---|
Similarity: | 74/205 - (36%) | Gaps: | 45/205 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 152 LNNAGIMFAPFKLTA------------DGY--ESHFAINFLGHFLLTHLLL-------PQLRAAG 195
Fly 196 K--EGRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTLLDAEKSHV 258
Fly 259 Q----VNVVHPGIVDTDLFEHSATTSVPIFKKL---FFKTPERGSRTVVFAAIDPSIEGQGGTYL 316
Fly 317 SNGGKGPFHP 326 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG11200 | NP_001286630.1 | PRK06196 | 56..344 | CDD:235736 | 49/205 (24%) |
NADB_Rossmann | 67..338 | CDD:304358 | 49/205 (24%) | ||
C2orf81 | NP_001303693.1 | DUF4639 | 9..614 | CDD:292118 | 49/205 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG1208 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |