DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and Rdh11

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001012193.1 Gene:Rdh11 / 362757 RGDID:1312001 Length:316 Species:Rattus norvegicus


Alignment Length:283 Identity:112/283 - (39%)
Similarity:167/283 - (59%) Gaps:16/283 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVGDLK 132
            ::|::||.|.|||....:.|......|.:..||.:..| .|||.:.......:::..:||:.|.|
  Rat    39 KVAIVTGANTGIGKETAKDLARRGARVYLACRDMQKGE-LVASEIQATTGNSQVLVRKLDLADTK 102

  Fly   133 SVKAFAQ--LIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAG 195
            |::|||:  |.:|:|  :.:|:||||:|..|:..||||:|.||.:|.|||||||||||.:|:.:|
  Rat   103 SIRAFAEGFLAEEKY--LHILINNAGVMMCPYSKTADGFEMHFGVNHLGHFLLTHLLLEKLKESG 165

  Fly   196 KEGRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTLLDAEKSHVQV 260
            .    ||:|||||..:.:|||::.:::|.|.|..|.||..||||.||||:.|...|  :.|.|..
  Rat   166 P----SRVVNVSSLAHHLGRIHFHNLHGEKFYSGGLAYCHSKLANILFTKELARRL--KGSRVTT 224

  Fly   261 NVVHPGIVDTDLFEHSATTSVPIFKKLFF---KTPERGSRTVVFAAIDPSIEGQGGTYLSNGGKG 322
            ..||||.|.::|..||  |::....:|||   |||::|::|.::.|:...|||..|::.|:....
  Rat   225 YSVHPGTVHSELIRHS--TALKWLWQLFFFFIKTPQQGAQTSLYCAVTEGIEGLSGSHFSDCQLA 287

  Fly   323 PFHPDAKKPAKCEQLFQFSCDLL 345
            .....|.......:|:..|||||
  Rat   288 WVSSQAGNETIARRLWDVSCDLL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 109/280 (39%)
NADB_Rossmann 67..338 CDD:304358 106/274 (39%)
Rdh11NP_001012193.1 NADB_Rossmann 38..306 CDD:419666 107/277 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.