DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and CG2064

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_610310.2 Gene:CG2064 / 35708 FlyBaseID:FBgn0033205 Length:330 Species:Drosophila melanogaster


Alignment Length:258 Identity:103/258 - (39%)
Similarity:140/258 - (54%) Gaps:14/258 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVGDLK 132
            ::.::||.|.|||.....::.....||.:..||....|.|...|:. ......:...:||:..|.
  Fly    44 KVFIVTGANTGIGKETALEIARRGGTVYLACRDMNRCEKARKDIIK-ETNNQNIFSRELDLSSLD 107

  Fly   133 SVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGKE 197
            |::.|....|:...|:.:|:||||:|..|..||.||||....:|.:||||||:|||..|    |.
  Fly   108 SIRKFVDGFKKEQPKLHVLINNAGVMRCPKTLTKDGYELQLGVNHIGHFLLTNLLLDVL----KN 168

  Fly   198 GRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTLLDAEKSHVQVNV 262
            ...||||.|||..:..|.||..|:|..|.|..|.||||||||.:||||.|...|  |.|.|.||.
  Fly   169 SAPSRIVVVSSLAHARGSINVADLNSEKSYDEGLAYSQSKLANVLFTRELAKRL--EGSGVTVNA 231

  Fly   263 VHPGIVDTDLFEHSA---TTSVPIFKK----LFFKTPERGSRTVVFAAIDPSIEGQGGTYLSN 318
            :|||:|||:|..:.|   |..|..|.|    ...|||:.|::|.::||:||.::...|.|.|:
  Fly   232 LHPGVVDTELARNWAFFQTNLVKFFLKPMIWPLLKTPKSGAQTSIYAALDPELKNISGLYFSD 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 103/258 (40%)
NADB_Rossmann 67..338 CDD:304358 103/258 (40%)
CG2064NP_610310.2 PRK06197 40..322 CDD:235737 103/258 (40%)
NADB_Rossmann 43..317 CDD:304358 103/258 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I1484
eggNOG 1 0.900 - - E2759_KOG1208
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I1353
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - otm46796
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.