DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and CG2065

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001260787.1 Gene:CG2065 / 35707 FlyBaseID:FBgn0033204 Length:300 Species:Drosophila melanogaster


Alignment Length:265 Identity:105/265 - (39%)
Similarity:144/265 - (54%) Gaps:17/265 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 KQPD---RIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQ 125
            ||.|   ::.::||.|.|||...|.::.....||.|..||....|.|...|: .......:...:
  Fly     8 KQTDETGKVFIVTGANTGIGKETVLEIAKRGGTVYMACRDMNRCEKARQDII-RETNNQNIFSRE 71

  Fly   126 LDVGDLKSVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQ 190
            ||:..|:|::.||...|:...|:.:|:||||:|..|..||.||:|....:|.:||||||||||..
  Fly    72 LDLSSLESIRKFAAGFKKEQDKLHVLINNAGVMHCPRTLTKDGFEMQLGVNHMGHFLLTHLLLDV 136

  Fly   191 LRAAGKEGRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTLLDAEK 255
            |    |:...||||||||.|:..|.|...|:|..|.|....||||||||.:||||.|...|  |.
  Fly   137 L----KKTAPSRIVNVSSLVHTQGFIKTADLNSEKSYSRIGAYSQSKLANVLFTRELAKRL--EG 195

  Fly   256 SHVQVNVVHPGIVDTDLFEHSATTSVPIFKKL-------FFKTPERGSRTVVFAAIDPSIEGQGG 313
            :.|..|.:|||.|||:|..:......|..:.|       .||||..|::|.::||:||:::...|
  Fly   196 TGVTTNSLHPGAVDTELSRNWKFLKHPFAQLLLKPLLWVLFKTPRNGAQTTLYAALDPALKDVSG 260

  Fly   314 TYLSN 318
            .|.|:
  Fly   261 LYFSD 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 105/265 (40%)
NADB_Rossmann 67..338 CDD:304358 103/262 (39%)
CG2065NP_001260787.1 PRK06197 11..294 CDD:235737 103/262 (39%)
NADB_Rossmann 14..288 CDD:304358 102/259 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I1484
eggNOG 1 0.900 - - E2759_KOG1208
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I1353
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - otm46796
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.