DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and CG2070

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001260786.1 Gene:CG2070 / 35706 FlyBaseID:FBgn0033203 Length:325 Species:Drosophila melanogaster


Alignment Length:281 Identity:110/281 - (39%)
Similarity:153/281 - (54%) Gaps:32/281 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGK-LICEQLDVGDL 131
            |:|::||.|:|||...|.:|.....||.|..||.|..|.|...|:  .||..: :...|||:..:
  Fly    44 RVAIVTGCNQGIGKETVLELARRGATVYMACRDMKKCENARREII--KATNNQNIFARQLDLCSM 106

  Fly   132 KSVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGK 196
            ||::.||...|...:|:.:|:||||||..|..||.||:|....:|.:||||||.|||..|:::..
  Fly   107 KSIRNFAAGFKREQNKLHILINNAGIMDCPKMLTEDGFEMQIGVNHMGHFLLTLLLLDVLKSSAP 171

  Fly   197 EGRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTLLDAEKSHVQVN 261
                ||:|.:||..:..|||...|:|..|.|....||.|||||.:||||.|...|..  :.|.||
  Fly   172 ----SRVVVLSSIAHRFGRIKRDDLNSEKSYDRKMAYCQSKLANVLFTRELAKRLSG--TGVTVN 230

  Fly   262 VVHPGIVDTDLFEHSATTSVPI----FKKL--------FFKTPERGSRTVVFAAIDPSIEGQGGT 314
            .:|||:|:|:||.::     |.    |.||        |.||...|::|.::||:|||:|...|.
  Fly   231 ALHPGVVNTELFRNT-----PFLGSWFGKLLIAPIIWIFIKTARNGAQTTLYAALDPSLEKVSGR 290

  Fly   315 YLSN------GGKGPFHPDAK 329
            |.|:      |....:..||:
  Fly   291 YFSDCKQKHVGSAAQYDDDAQ 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 110/281 (39%)
NADB_Rossmann 67..338 CDD:304358 110/281 (39%)
CG2070NP_001260786.1 PRK06197 41..323 CDD:235737 110/281 (39%)
NADB_Rossmann 43..317 CDD:304358 110/281 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I1484
eggNOG 1 0.900 - - E2759_KOG1208
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I1353
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - otm46796
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.