DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and Wwox

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001285735.1 Gene:Wwox / 34090 FlyBaseID:FBgn0031972 Length:409 Species:Drosophila melanogaster


Alignment Length:298 Identity:79/298 - (26%)
Similarity:136/298 - (45%) Gaps:39/298 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIV-DLNATKGKLICEQLDVGDL 131
            |.|:|||.|.|||......|......::...|:...||.|:..|. :..|.:.:.....||:..|
  Fly   122 RTALITGANCGIGYETARSLAHHGCEIIFACRNRSSAEAAIERIAQERPAARSRCRFAALDLSSL 186

  Fly   132 KSVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGK 196
            :||:.|.:.||:..|.:|.|:.|||:...|:..|.||.|:.|.::.|.||.||      |:....
  Fly   187 RSVQRFVEEIKQSVSHIDYLILNAGVFALPYTRTVDGLETTFQVSHLSHFYLT------LQLETL 245

  Fly   197 EGRNSRIVNVSSCVNLIGRINYKDINGTKH-------YYPGTAYSQSKLAQILFTRHLQTLLDAE 254
            ....:||:.:||..:....:..::: ...|       |:...||:.:||..:||.:.|....  :
  Fly   246 FDYKTRIIVLSSESHRFANLPVENL-AVHHLSPPPEKYWSMMAYNNAKLCNVLFAQELAQRW--K 307

  Fly   255 KSHVQVNVVHPG-IVDTDLFEHSATTSVPIFKKLFF-------KTPERGSRTVVFAAIDPSIEGQ 311
            :..:.|..:||| :|.:||..:.      .|.:|.|       |:.::.:.|.::.|....:.|.
  Fly   308 QRGISVFSLHPGNMVSSDLSRNY------WFYRLLFAIVRPFTKSLQQAAATSIYCATANELTGL 366

  Fly   312 GGTYLSNGGKGPFHPDAKKPAKC----EQLFQFSCDLL 345
            .|.|.:|    .|..:..|.:|.    :||::.|.:|:
  Fly   367 SGLYFNN----CFFCEPSKLSKSAALQQQLWKLSENLI 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 78/295 (26%)
NADB_Rossmann 67..338 CDD:304358 76/289 (26%)
WwoxNP_001285735.1 WW 13..43 CDD:197736
WW 54..86 CDD:197736
PRK06196 104..402 CDD:235736 79/298 (27%)
human_WWOX_like_SDR_c-like 121..402 CDD:187669 79/298 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 60 1.000 Domainoid score I2553
eggNOG 1 0.900 - - E2759_KOG1208
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I1353
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.960

Return to query results.
Submit another query.