DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and rdh14b

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001040655.1 Gene:rdh14b / 334665 ZFINID:ZDB-GENE-030131-6605 Length:323 Species:Danio rerio


Alignment Length:260 Identity:98/260 - (37%)
Similarity:145/260 - (55%) Gaps:18/260 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNAT-KGKLICEQLDVGDL 131
            :..::||.|.|||.....:||.....|:|..||.:.||.|...|.:...| :|:::.:.||:..|
Zfish    42 KTVIVTGANCGIGKATAAELLKLQARVIMACRDRQRAEDAARDIQNQAGTSQGEIVIKHLDLASL 106

  Fly   132 KSVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGK 196
            :||:.|.:.:.....::|:|:||||:...|:..|.:|:|....:|.|||||||:|||..|    |
Zfish   107 QSVRRFCEEVIREEPRIDVLINNAGLYQCPYSKTEEGFEMQLGVNHLGHFLLTNLLLDLL----K 167

  Fly   197 EGRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTLLDAEKSHVQVN 261
            :...||:|.|||.:...|.||::|:|..:.|.....|||||||.:||||.|...||.  :.|.||
Zfish   168 QSSPSRVVVVSSKLYKYGSINFEDLNSEQSYNKSFCYSQSKLANLLFTRELARRLDG--TEVTVN 230

  Fly   262 VVHPGIVDTDLFEHSATTSVPIFKK--------LFFKTPERGSRTVVFAAIDPSIEGQGGTYLSN 318
            .:.||||.|.|..|   .::|:..|        ||||:|..|::|.::.|..|.:||..|...:|
Zfish   231 ALTPGIVRTRLGRH---VNIPLLIKPLFWLVSWLFFKSPLEGAQTPLYLACSPEVEGVSGKCFAN 292

  Fly   319  318
            Zfish   293  292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 98/260 (38%)
NADB_Rossmann 67..338 CDD:304358 98/260 (38%)
rdh14bNP_001040655.1 PRK06197 41..322 CDD:235737 98/260 (38%)
NADB_Rossmann 41..315 CDD:304358 98/260 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.