DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and CG3842

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001259270.1 Gene:CG3842 / 31576 FlyBaseID:FBgn0029866 Length:406 Species:Drosophila melanogaster


Alignment Length:368 Identity:129/368 - (35%)
Similarity:188/368 - (51%) Gaps:57/368 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLWIFFVGLLLCAFLFSKTTKEFPKSWFEWKTEFRYQYLGIVGLVHDAQYKARDRVALYKQPDRI 69
            |:::..:|:||..:|..|                         .:....|:..:|:     ..::
  Fly    42 LIFLIVLGILLFMWLLRK-------------------------CIQGPAYRKANRI-----DGKV 76

  Fly    70 AVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVGDLKSV 134
            .::||.|.|||...|.:|......|.|..|||...|.|...|:|.:..: :|....||:|.|:||
  Fly    77 VIVTGCNTGIGKETVLELAKRGARVYMACRDPGRCEAARLDIMDRSRNQ-QLFNRTLDLGSLQSV 140

  Fly   135 KAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGKEGR 199
            :.|.:..|...|::|:|:||||:|..|..|||||:|..|.:|.|||||||:|||.:|    |...
  Fly   141 RNFVERFKAEESRLDILINNAGVMACPRTLTADGFEQQFGVNHLGHFLLTNLLLDRL----KHSS 201

  Fly   200 NSRIVNVSSCVNLIGRINYKDINGTKHY--YPGTAYSQSKLAQILFTRHLQTLLDAEKSHVQVNV 262
            .||||.|||..:|.||||.:|:...|:|  :.| ||||||||.||||..|.|:|  :.:.|.||.
  Fly   202 PSRIVVVSSAAHLFGRINREDLMSEKNYSKFFG-AYSQSKLANILFTLKLSTIL--KDTGVTVNC 263

  Fly   263 VHPGIVDTDLFEHSA-----TTSVPIFKKLFFKTPERGSRTVVFAAIDPSIEGQGGTYLSNGGKG 322
            .|||:|.|::..|.:     .|::......|||||:.|::|.:..|:||.:||..|.|.|:..:.
  Fly   264 CHPGVVRTEINRHFSGPGWMKTALQKGSLYFFKTPKAGAQTQLRLALDPQLEGSTGGYYSDCMRW 328

  Fly   323 PFHPDAKKPAKCEQLFQFSCDLLKI------------QQYGNG 353
            |..|..:.....:.|::.|..||.:            .|.|||
  Fly   329 PLFPWVRNMQTADWLWRESEKLLGLPPLEPPPPVQSPTQNGNG 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 116/294 (39%)
NADB_Rossmann 67..338 CDD:304358 113/277 (41%)
CG3842NP_001259270.1 FabG 71..319 CDD:223959 109/260 (42%)
NADB_Rossmann 74..347 CDD:304358 114/280 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 118 1.000 Domainoid score I1484
eggNOG 1 0.900 - - E2759_KOG1208
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 113 1.000 Inparanoid score I1353
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 1 1.000 - - otm46796
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
76.960

Return to query results.
Submit another query.