DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and Cbr3

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001100580.1 Gene:Cbr3 / 304078 RGDID:1309728 Length:277 Species:Rattus norvegicus


Alignment Length:303 Identity:81/303 - (26%)
Similarity:119/303 - (39%) Gaps:83/303 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RIAVITGGNRGIGLRIVEKLLAC---DMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVG 129
            |:|::||.|:|||..|...|  |   ...||:..||......||.   .|.|........|||:.
  Rat     6 RVALVTGANKGIGFAITRDL--CRKFSGDVVLTARDEARGRAAVK---QLQAEGLSPRFHQLDID 65

  Fly   130 DLKSVKAFAQLIKERYSKVDLLLNNAGIMF-----APFKLTADGYESHFAINFLGHFLLTHLLLP 189
            :.:|::|....:::.|..:::|:|||||.|     .||.:.|   |.....||.....:...|||
  Rat    66 NPQSIRALRDFLRKEYGGLNVLVNNAGIAFRMDDPTPFDVQA---EVTLKTNFFATRNVCTELLP 127

  Fly   190 QLRAAGKEGRNSRIVNVSSCVNLIGRIN-----------------------YKDINGTKHY---- 227
            .::..|      |:|||||...|....|                       .|.:..||:.    
  Rat   128 IMKPHG------RVVNVSSLQGLKALENCSEDLQERFRCDTLTEGDLVDLMKKFVEDTKNEVHER 186

  Fly   228 --YPGTAYSQSKLAQILFTRHLQTLLDAEK--SHVQVNVVHPGIVDTDLFEHSATTSVPIFKKLF 288
              :|.:||..|||...:.||.|...||.::  ..:.:|...||.|.||:.....:          
  Rat   187 EGWPDSAYGVSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMARDQGS---------- 241

  Fly   289 FKTPERGSRTVVFAAIDPSIEGQGGTYLSNGGKGPFHPDAKKP 331
             :|.|.|:.|.|:.|:.|                   |||.:|
  Rat   242 -RTVEEGAETPVYLALLP-------------------PDATEP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 81/303 (27%)
NADB_Rossmann 67..338 CDD:304358 81/303 (27%)
Cbr3NP_001100580.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 81/303 (27%)
adh_short 6..241 CDD:278532 70/248 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.