DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and Cbr1

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_062043.1 Gene:Cbr1 / 29224 RGDID:2286 Length:277 Species:Rattus norvegicus


Alignment Length:295 Identity:83/295 - (28%)
Similarity:129/295 - (43%) Gaps:70/295 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 DR-IAVITGGNRGIGLRIVEKLLACDM---TVVMGVRDPKIAETAVASIVDLNATKG-KLICEQL 126
            || :|::||.|:|||..||..|  |..   .||:..||......||..:    .|:| .....||
  Rat     4 DRPVALVTGANKGIGFAIVRDL--CRKFLGDVVLTARDESRGHEAVKQL----QTEGLSPRFHQL 62

  Fly   127 DVGDLKSVKAFAQLIKERYSKVDLLLNNAGIMF-----APFKLTADGYESHFAINFLGHFLLTHL 186
            |:.:.:|::|....:.:.|..:::|:|||||.|     .||.:.|   |.....||.|...:...
  Rat    63 DIDNPQSIRALRDFLLQEYGGLNVLVNNAGIAFKVVDPTPFHIQA---EVTMKTNFFGTQDVCKE 124

  Fly   187 LLPQLRAAGKEGRNSRIVNVSSCVN------------------------LIGRIN------YKDI 221
            |||.::..|      |:|||||.|:                        |:|.:|      .|.:
  Rat   125 LLPIIKPQG------RVVNVSSSVSLRALKSCSPELQQKFRSETITEEELVGLMNKFIEDAKKGV 183

  Fly   222 NGTKHYYPGTAYSQSKLAQILFTRHLQTLLDAEK--SHVQVNVVHPGIVDTDLFEHSATTSVPIF 284
            : .|..:|.:||..:|:...:.:|.....|:.|:  ..:.:|...||.|.||:....||      
  Rat   184 H-AKEGWPNSAYGVTKIGVTVLSRIYARKLNEERREDKILLNACCPGWVRTDMAGPKAT------ 241

  Fly   285 KKLFFKTPERGSRTVVF-AAIDPSIEGQGGTYLSN 318
                 |:||.|:.|.|: |.:.|..||..|.::.:
  Rat   242 -----KSPEEGAETPVYLALLPPGAEGPHGQFVQD 271

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 83/295 (28%)
NADB_Rossmann 67..338 CDD:304358 83/295 (28%)
Cbr1NP_062043.1 carb_red_PTCR-like_SDR_c 7..277 CDD:187585 81/292 (28%)
adh_short 7..239 CDD:278532 68/247 (28%)
Glutathione binding. /evidence=ECO:0000250|UniProtKB:P16152 95..97 1/1 (100%)