DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and Wwox

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_006255728.1 Gene:Wwox / 292041 RGDID:1309927 Length:414 Species:Rattus norvegicus


Alignment Length:271 Identity:83/271 - (30%)
Similarity:131/271 - (48%) Gaps:37/271 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVGDLK 132
            ::.::||.|.|||....:........|::..|:...|..||:.|:: ...|.|:....||:..|:
  Rat   125 KVVLVTGANSGIGFETAKSFALHGAHVILACRNMSRASEAVSRILE-EWHKAKVEAMTLDLAVLR 188

  Fly   133 SVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQL-RAAGK 196
            ||:.||:..|.:...:.:|:.|||....|:.||.||.|:.|.:|.||||.|..||...| |:|  
  Rat   189 SVQHFAEAFKAKNVPLHILVCNAGTFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSA-- 251

  Fly   197 EGRNSRIVNVSSCVNLIGRINYKDIN-------------GTKHYYPGTAYSQSKLAQILFTRHLQ 248
               .:|::.|||..:     .:.|||             .:..|:...||::|||..|||:..|.
  Rat   252 ---PARVIVVSSESH-----RFTDINDSSGKLDLSRLSLSSSDYWAMLAYNRSKLCNILFSNELH 308

  Fly   249 TLLDAEKSHVQVNVVHPGIVDTDLFEHSATTSVPIFKKL------FFKTPERGSRTVVFAAIDPS 307
            .||...  .|..|.:|||.:.......::.    ::|.|      |.|:.::|:.|.|:.|:.|.
  Rat   309 RLLSPR--GVTSNALHPGNMMFSAIHRNSW----VYKLLFTLARPFTKSMQQGAATTVYCAVAPE 367

  Fly   308 IEGQGGTYLSN 318
            :||.||.|.:|
  Rat   368 LEGLGGMYFNN 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 83/271 (31%)
NADB_Rossmann 67..338 CDD:304358 83/271 (31%)
WwoxXP_006255728.1 WW 18..47 CDD:395320
WW 60..90 CDD:238122
human_WWOX_like_SDR_c-like 124..407 CDD:187669 83/271 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.