DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and Dhrsx

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_006249055.1 Gene:Dhrsx / 288525 RGDID:1305017 Length:331 Species:Rattus norvegicus


Alignment Length:259 Identity:106/259 - (40%)
Similarity:145/259 - (55%) Gaps:11/259 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QPDRIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVG 129
            |.||:|::||..||:||....:|....|.|::...|.......||.|.:.:..:..... .||:.
  Rat    39 QADRVAIVTGATRGVGLSTACQLARLGMRVIVAGNDEHRGHEVVARIQEESGPESAHFL-FLDLA 102

  Fly   130 DLKSVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAA 194
            .|.||::|.:..:.....:.||:||||:|..|...|.||:|.|..:|||||||||.||||.|||:
  Rat   103 SLSSVRSFVRNFEATALPLHLLINNAGVMLDPSGNTKDGFERHVGVNFLGHFLLTSLLLPALRAS 167

  Fly   195 GKEGRNSRIVNVSSCVNLIGRINYKDINGTKHYYPG----TAYSQSKLAQILFTRHLQTLLDAEK 255
            |.:||.||::.|.|..:.:|:.:...:.|..   |.    .||:.||||..||:..||.||.|..
  Rat   168 GHQGRKSRVITVCSSTHWVGQADVARLLGQS---PAPCALAAYAGSKLALALFSLRLQRLLSALG 229

  Fly   256 SHVQVNVVHPGIVDTDLFEHS--ATTSVPIFKK-LFFKTPERGSRTVVFAAIDPSIEGQGGTYL 316
            ..|..|:|.||:|||.||.|:  .|.:|..|.. |.||||:.|:.|.|:||..|.:||.||.||
  Rat   230 DPVTANIVDPGVVDTALFAHAGWGTRAVQRFLGWLLFKTPDEGAWTSVYAAASPKLEGIGGRYL 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 106/259 (41%)
NADB_Rossmann 67..338 CDD:304358 105/257 (41%)
DhrsxXP_006249055.1 PRK06197 36..326 CDD:235737 106/259 (41%)
NADB_Rossmann 41..315 CDD:304358 105/257 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H78041
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1164708at2759
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108579
Panther 1 1.100 - - LDO PTHR24320
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X5858
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1110.780

Return to query results.
Submit another query.