DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and Dhrsx

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001028498.2 Gene:Dhrsx / 236082 MGIID:2181510 Length:335 Species:Mus musculus


Alignment Length:256 Identity:108/256 - (42%)
Similarity:149/256 - (58%) Gaps:6/256 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QPDRIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASI-VDLNATKGKLICEQLDV 128
            ||.|:|::||...|||.....:|....|.||:...|....:..|:|| .::.:.:...:  .||:
Mouse    41 QPGRVAIVTGATAGIGRSTARQLARLGMCVVVAGNDEHCGQEVVSSIRAEMGSDRAHFL--PLDL 103

  Fly   129 GDLKSVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRA 193
            ..|.||:.||:..:.....:.||:||||:|..|...|.||:|.|..:|||||||||.||||.|||
Mouse   104 ASLASVRGFARDFRALGLPLHLLVNNAGVMLEPRAETEDGFERHLGVNFLGHFLLTLLLLPALRA 168

  Fly   194 AGKEGRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTLLDAEKSHV 258
            :|.|||.||:|.|.|..:.:|.::..|::|...|.|..||:|||||..||...||.:|||....|
Mouse   169 SGAEGRGSRVVTVGSATHYVGTVDMADLHGRHAYSPYAAYAQSKLALALFALQLQRILDARGDPV 233

  Fly   259 QVNVVHPGIVDTDLFEHSA---TTSVPIFKKLFFKTPERGSRTVVFAAIDPSIEGQGGTYL 316
            ..|:..||:|||:|:.|:.   .|.......|.||:||.|:.|:|:||..|.:||.||.||
Mouse   234 TSNMADPGVVDTELYRHAGWVLRTVKRFLGWLVFKSPEEGAWTLVYAAAAPELEGVGGRYL 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 108/256 (42%)
NADB_Rossmann 67..338 CDD:304358 106/254 (42%)
DhrsxNP_001028498.2 PRK06197 38..324 CDD:235737 108/256 (42%)
retinol-DH_like_SDR_c_like 43..316 CDD:212492 106/254 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 157 1.000 Domainoid score I4169
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H78041
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5858
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
88.010

Return to query results.
Submit another query.