DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and K10H10.6

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001364610.1 Gene:K10H10.6 / 187285 WormBaseID:WBGene00010762 Length:321 Species:Caenorhabditis elegans


Alignment Length:260 Identity:82/260 - (31%)
Similarity:117/260 - (45%) Gaps:28/260 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDL--NATKGKLICEQLDVGDLKSV 134
            |||...|||:...|.|......||:..|:.:.:||....|::.  :|....:.|   |:.|||:.
 Worm    32 ITGTTSGIGVDTAEVLALAGAHVVLINRNLRASETQKRKILEKKPDAKVDIIYC---DLSDLKTA 93

  Fly   135 -KAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGKEG 198
             ||..:.:|:::....|:| |||:.......|.||.||||.:|.|.||.|..:|||.:|.:..  
 Worm    94 RKAGEEYLKKKWPIHGLIL-NAGVFQPAVAKTKDGLESHFGVNVLAHFTLLRILLPVVRLSAP-- 155

  Fly   199 RNSRIVNVSSCVNLIGRINYKDINGTKHYY------PGTA-----YSQSKLAQILFTRHLQTLLD 252
              ||||.:||  .|..|..:|...|.....      ..:|     |..||:|.:|....|..  |
 Worm   156 --SRIVILSS--TLSSRHGFKKSMGITEKLKILQEEKASASSLQLYGASKMADMLIAFKLHR--D 214

  Fly   253 AEKSHVQVNVVHPGI-VDTDLFEHSATTSV-PIFKKLFFKTPERGSRTVVFAAIDPSIEGQGGTY 315
            ..|:.:....||||. |.||:|..|....| .:......|...:|:.|.|:.|..|.:|...|.|
 Worm   215 EYKNEISTYFVHPGDGVRTDIFRDSTLGKVLTVLSTPCIKNCSQGAATTVYCATHPEVEKISGKY 279

  Fly   316  315
             Worm   280  279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 82/260 (32%)
NADB_Rossmann 67..338 CDD:304358 82/260 (32%)
K10H10.6NP_001364610.1 NADB_Rossmann 27..304 CDD:419666 82/260 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.