DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and E04F6.15

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_495501.1 Gene:E04F6.15 / 184041 WormBaseID:WBGene00017131 Length:319 Species:Caenorhabditis elegans


Alignment Length:281 Identity:90/281 - (32%)
Similarity:132/281 - (46%) Gaps:27/281 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVGDLKSVKA 136
            |||...|||:...:.|:.....|||..|:...:|.:..|:: :.....::...|.|:..|.|||.
 Worm    33 ITGTTSGIGVETAKALILKGAHVVMINRNYTASEASKKSLL-IETPNAQIDIVQCDLNSLSSVKK 96

  Fly   137 FAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGKEGRNS 201
            .|....|:...:..|:.|||:.....|.|:||:|:||.||.|.||:|...|||.||    |...|
 Worm    97 AADEYLEQKWPLHGLILNAGVFGPSEKTTSDGFEAHFGINHLAHFILIKELLPVLR----ESAPS 157

  Fly   202 RIVNVSS------CVNLIGRINYK-----DINGTKHYYPGTAYSQSKLAQIL--FTRHLQTLLDA 253
            |||.|:|      ||....||..|     ....|:.|:  ..|::||:..||  |..|    .|.
 Worm   158 RIVIVTSMLSKHTCVKPDSRIVEKLDTLCPKEATQWYF--RLYAKSKMCNILTAFKLH----RDE 216

  Fly   254 EKSHVQVNVVHPGI-VDTDLFEHSATTSVPIFKKL-FFKTPERGSRTVVFAAIDPSIEGQGGTYL 316
            .|:.:.|..||||. |.|||.......|:..|..: |.|...:|:.|.::.|:.|.::...|.|.
 Worm   217 FKNRISVYAVHPGSGVRTDLHRDFGLWSIADFLSIPFTKNASQGAATSLYCAVHPEVKELSGKYW 281

  Fly   317 SNGGKGPFHPDAKKPAKCEQL 337
            .:......:.| ||.::.|:|
 Worm   282 ESCWDDEKNLD-KKVSRDEEL 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 90/281 (32%)
NADB_Rossmann 67..338 CDD:304358 90/281 (32%)
E04F6.15NP_495501.1 PRK06196 11..312 CDD:235736 90/281 (32%)
retinol-DH_like_SDR_c_like 28..306 CDD:212492 90/281 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.