DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and DC2.5

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_503155.4 Gene:DC2.5 / 183970 WormBaseID:WBGene00017082 Length:337 Species:Caenorhabditis elegans


Alignment Length:302 Identity:89/302 - (29%)
Similarity:135/302 - (44%) Gaps:49/302 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    72 ITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLICE---------QLD 127
            |||...|:|.......:.....:||..|:...:||          .|..|:||         |.|
 Worm    50 ITGTTSGVGTETARAFILKGAHIVMINRNYAASET----------LKQSLLCETPDARIDIVQCD 104

  Fly   128 VGDLKSVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLR 192
            :..|.|||..|:....:...:..|:.|||::....|.|||.:|:||.||.|.||||...|||.||
 Worm   105 LSSLASVKKTAEEYLTKKWPLHGLILNAGVLGRKEKTTADRFEAHFGINHLAHFLLIKELLPVLR 169

  Fly   193 AAGKEGRNSRIVNVSSCVNLIGRINYKD-----------INGTKHYYPGTAYSQSKLAQILFTRH 246
            ::..    ||||.:||.::....||...           .|.|:.||  ..|::||:..:|....
 Worm   170 SSAP----SRIVILSSTLSKFTSINPDSKIEEKLGTLCPKNATEWYY--RLYAKSKMCNMLIAFK 228

  Fly   247 LQTLLDAEKSHVQVNVVHPG-IVDTDLFEHSATTSVPIFKKL---FFKTPERGSRTVVFAAIDPS 307
            |..  |..::.:.|..|||| .|.|:|  |.......||..|   |.|...:|:.|.::.|:.|.
 Worm   229 LHR--DEFENGISVYSVHPGSAVRTNL--HRDVPFWSIFNFLSIPFTKNASQGAATSLYCAVHPE 289

  Fly   308 IEGQGGTYLSNGGKGPFHPDAKKPAKCEQ----LFQFSCDLL 345
            ::...|.|..:......:.| :|.|:.|:    |:::|.:|:
 Worm   290 VQELSGRYWESCWDDELNLD-EKVARDEELQEALWEYSEELV 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 88/299 (29%)
NADB_Rossmann 67..338 CDD:304358 86/293 (29%)
DC2.5NP_503155.4 PRK06196 28..331 CDD:235736 89/302 (29%)
retinol-DH_like_SDR_c_like 45..323 CDD:212492 86/293 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.