DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and Rdh11

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_067532.2 Gene:Rdh11 / 17252 MGIID:102581 Length:316 Species:Mus musculus


Alignment Length:290 Identity:109/290 - (37%)
Similarity:162/290 - (55%) Gaps:26/290 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PDRIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKG--KLICEQLDV 128
            |.::|::||.|.|||....:.|......|.:..||....|.|..   ::.|..|  ::...:||:
Mouse    37 PGKVAIVTGANTGIGKETAKDLAQRGARVYLACRDVDKGELAAR---EIQAVTGNSQVFVRKLDL 98

  Fly   129 GDLKSVKAFAQ--LIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQL 191
            .|.||::|||:  |.:|::  :.||:||||:|..|:..||||:|.|..:|.|||||||||||.:|
Mouse    99 ADTKSIRAFAKDFLAEEKH--LHLLINNAGVMMCPYSKTADGFEMHIGVNHLGHFLLTHLLLEKL 161

  Fly   192 RAAGKEGRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTLLDAEKS 256
                ||...|||||:||..:.:|||::.::.|.|.|..|.||..||||.||||:.|...|  :.|
Mouse   162 ----KESAPSRIVNLSSLGHHLGRIHFHNLQGEKFYSAGLAYCHSKLANILFTKELAKRL--KGS 220

  Fly   257 HVQVNVVHPGIVDTDLFEHSATTSVPIFK---KLFF---KTPERGSRTVVFAAIDPSIEGQGGTY 315
            .|....||||.|.::|..:|:     |.:   :|||   |||:.|::|.::.|:...:|...|::
Mouse   221 GVTTYSVHPGTVHSELTRYSS-----IMRWLWQLFFVFIKTPQEGAQTSLYCALTEGLESLSGSH 280

  Fly   316 LSNGGKGPFHPDAKKPAKCEQLFQFSCDLL 345
            .|:..........:......:|:..|||||
Mouse   281 FSDCQLAWVSYQGRNEIIARRLWDVSCDLL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 106/287 (37%)
NADB_Rossmann 67..338 CDD:304358 102/280 (36%)
Rdh11NP_067532.2 PRK06197 38..311 CDD:235737 108/289 (37%)
NADB_Rossmann 38..306 CDD:304358 103/283 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.