DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and dhs-1

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_491557.1 Gene:dhs-1 / 172172 WormBaseID:WBGene00000965 Length:323 Species:Caenorhabditis elegans


Alignment Length:273 Identity:84/273 - (30%)
Similarity:128/273 - (46%) Gaps:42/273 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    71 VITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVD-LNATKGKLICEQ-----LDVG 129
            ::||...|:||...:.|......|::..||......||.|::. ::..:.:...|:     |||.
 Worm     7 LVTGSTCGLGLHTAKILFKKGANVILTCRDEIRGRHAVESLLSGVSQEQSQKEAERIHLFTLDVT 71

  Fly   130 DLKSVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAA 194
            :..|:..|...|...:..:.:::||||||..||:|:.||.|.|||.|..||:::...|||.|...
 Worm    72 NYNSICNFTDEISRMFKYLHVIINNAGIMGMPFELSVDGIEMHFATNVFGHYVVVERLLPLLLKT 136

  Fly   195 GKEGRNSRIVNVSSCV-----------NLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQ 248
            .:....||::.|||.:           .|:|:..|       .|.|..||:.||||..|:|..|.
 Worm   137 DRPDFKSRVIVVSSGLYRNAEAIPQVSKLLGQKTY-------DYSPKQAYAFSKLANCLYTGALS 194

  Fly   249 TLLDAEKSHVQVNVVHPGIVD-TDLFEHS----ATTSVPIFKKLFF--KTPERGSRTVVFAAIDP 306
            .:|  |..:|.|..|.||.|: |:|...:    ...:.||   ::|  ||.|:|..|:|:.|   
 Worm   195 KML--EPHNVGVYCVRPGFVNGTELGRETHWILRALAAPI---IWFIAKTLEQGCETIVYLA--- 251

  Fly   307 SIEGQGGTYLSNG 319
               ...|..|.||
 Worm   252 ---ETSGNQLKNG 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 84/273 (31%)
NADB_Rossmann 67..338 CDD:304358 84/273 (31%)
dhs-1NP_491557.1 adh_short 5..220 CDD:278532 70/221 (32%)
NADB_Rossmann 6..274 CDD:304358 84/273 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG46156
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_108579
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
65.680

Return to query results.
Submit another query.