DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and RDH12

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_689656.2 Gene:RDH12 / 145226 HGNCID:19977 Length:316 Species:Homo sapiens


Alignment Length:285 Identity:104/285 - (36%)
Similarity:161/285 - (56%) Gaps:10/285 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PDRIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVGD 130
            |.::.||||.|.|||.....:|.:....|.:..||....|:| ||.:.::....:::..:||:.|
Human    38 PGKVVVITGANTGIGKETARELASRGARVYIACRDVLKGESA-ASEIRVDTKNSQVLVRKLDLSD 101

  Fly   131 LKSVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAG 195
            .||::|||:.......::.:|:||||:|..|:..||||:|:|..:|.|||||||:|||.:|:.:.
Human   102 TKSIRAFAEGFLAEEKQLHILINNAGVMMCPYSKTADGFETHLGVNHLGHFLLTYLLLERLKVSA 166

  Fly   196 KEGRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTLLDAEKSHVQV 260
            .    :|:|||||..:.||:|.:.|:...|.|..|.||..||||.:||||.|...|  :.:.|..
Human   167 P----ARVVNVSSVAHHIGKIPFHDLQSEKRYSRGFAYCHSKLANVLFTRELAKRL--QGTGVTT 225

  Fly   261 NVVHPGIVDTDLFEHSATTSV--PIFKKLFFKTPERGSRTVVFAAIDPSIEGQGGTYLSNGGKGP 323
            ..||||:|.::|..||:...:  .:|.. |.||...|::|.:..|:...:|...|.|.|:..:..
Human   226 YAVHPGVVRSELVRHSSLLCLLWRLFSP-FVKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRTW 289

  Fly   324 FHPDAKKPAKCEQLFQFSCDLLKIQ 348
            ..|.|:.....|:|:..||:||.|:
Human   290 VSPRARNNKTAERLWNVSCELLGIR 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 101/279 (36%)
NADB_Rossmann 67..338 CDD:304358 97/272 (36%)
RDH12NP_689656.2 retinol-DH_like_SDR_c 39..307 CDD:212495 98/275 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.