DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and RDH13

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001139443.1 Gene:RDH13 / 112724 HGNCID:19978 Length:331 Species:Homo sapiens


Alignment Length:297 Identity:102/297 - (34%)
Similarity:156/297 - (52%) Gaps:27/297 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 PDRIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLI-----CEQ 125
            |.:..::||.|.|||.:...:|......:::..||.:..|.|...|      :|:.:     ...
Human    37 PGKTVIVTGANTGIGKQTALELARRGGNIILACRDMEKCEAAAKDI------RGETLNHHVNARH 95

  Fly   126 LDVGDLKSVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQ 190
            ||:..|||::.||..|.|...:||:|:||||:|..|...|.||:|..|.:|.|||||||:|||.:
Human    96 LDLASLKSIREFAAKIIEEEERVDILINNAGVMRCPHWTTEDGFEMQFGVNHLGHFLLTNLLLDK 160

  Fly   191 LRAAGKEGRNSRIVNVSSCVNLIGRINYKDIN-GTKHYYPGTAYSQSKLAQILFTRHLQTLLDAE 254
            |:|:..    |||:|:||..::.|.|::.|:| .|:.|....||.|||||.:|||:.|...|  :
Human   161 LKASAP----SRIINLSSLAHVAGHIDFDDLNWQTRKYNTKAAYCQSKLAIVLFTKELSRRL--Q 219

  Fly   255 KSHVQVNVVHPGIVDTDLFEH--------SATTSVPIFKKLFFKTPERGSRTVVFAAIDPSIEGQ 311
            .|.|.||.:|||:..|:|..|        |:||..||| .|..|:||..::...:.|:...:...
Human   220 GSGVTVNALHPGVARTELGRHTGIHGSTFSSTTLGPIF-WLLVKSPELAAQPSTYLAVAEELADV 283

  Fly   312 GGTYLSNGGKGPFHPDAKKPAKCEQLFQFSCDLLKIQ 348
            .|.|.....:....|:|:......:|:..|..|:.::
Human   284 SGKYFDGLKQKAPAPEAEDEEVARRLWAESARLVGLE 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 101/291 (35%)
NADB_Rossmann 67..338 CDD:304358 98/284 (35%)
RDH13NP_001139443.1 retinol-DH_like_SDR_c 38..313 CDD:212495 99/287 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.