DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and Cbr3

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_766635.1 Gene:Cbr3 / 109857 MGIID:1309992 Length:277 Species:Mus musculus


Alignment Length:304 Identity:82/304 - (26%)
Similarity:123/304 - (40%) Gaps:85/304 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RIAVITGGNRGIGLRIVEKLLAC---DMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVG 129
            |:|::||.|:|||..|...|  |   ...||:..||......||.   .|.|........|||:.
Mouse     6 RVALVTGANKGIGFAITRDL--CRKFSGDVVLTARDEARGRAAVQ---QLQAEGLSPRFHQLDID 65

  Fly   130 DLKSVKAFAQLIKERYSKVDLLLNNAGIMF-----APFKLTADGYESHFAINFLGHFLLTHLLLP 189
            |.:|::|....:::.|..:::|:|||||.|     .||.:.|   |.....||.....:...|||
Mouse    66 DPQSIRALRDFLRKEYGGLNVLVNNAGIAFRMDDPTPFDIQA---EVTLKTNFFATRNVCTELLP 127

  Fly   190 QLRAAGKEGRNSRIVNVSS-------------------C-----VNLIGRINYKDINGTKHY--- 227
            .::..|      |:||:||                   |     |:|:..:. |.:..||:.   
Mouse   128 IMKPHG------RVVNISSLQGLKALENCREDLQEKFRCDTLTEVDLVDLMK-KFVEDTKNEVHE 185

  Fly   228 ---YPGTAYSQSKLAQILFTRHLQTLLDAEK--SHVQVNVVHPGIVDTDLFEHSATTSVPIFKKL 287
               :|.:||..|||...:.||.|...||.::  ..:.:|...||.|.||:.....:         
Mouse   186 REGWPDSAYGVSKLGVTVLTRILARQLDEKRKADRILLNACCPGWVKTDMARDQGS--------- 241

  Fly   288 FFKTPERGSRTVVFAAIDPSIEGQGGTYLSNGGKGPFHPDAKKP 331
              :|.|.|:.|.|:.|:.|                   |||.:|
Mouse   242 --RTVEEGAETPVYLALLP-------------------PDATEP 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 82/304 (27%)
NADB_Rossmann 67..338 CDD:304358 82/304 (27%)
Cbr3NP_766635.1 carb_red_PTCR-like_SDR_c 6..277 CDD:187585 82/304 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.