DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and Rdh13

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_780581.1 Gene:Rdh13 / 108841 MGIID:1918732 Length:334 Species:Mus musculus


Alignment Length:322 Identity:105/322 - (32%)
Similarity:166/322 - (51%) Gaps:31/322 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 LGIVGLVHDAQYKARDRVA------LYKQPDRIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDP 101
            :.:||.|.......:|.||      ....|.:..::||.|.|||.:...:|......|::..||.
Mouse     8 VSVVGTVIGGTVLLKDYVAGGACPSKATIPGKTVIVTGANTGIGKQTALELAKRGGNVILACRDM 72

  Fly   102 KIAETAVASIVDLNATKGKLI-----CEQLDVGDLKSVKAFAQLIKERYSKVDLLLNNAGIMFAP 161
            :..|.|...|      :|:.:     .|:||:..|||::.||:.:.:...:||:|:|||.:|..|
Mouse    73 EKCEVAAKDI------RGETLNPRVRAERLDLASLKSIREFARKVIKEEERVDILVNNAAVMRCP 131

  Fly   162 FKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGKEGRNSRIVNVSSCVNLIGRINYKDIN-GTK 225
            ...|.||:|..|.:|:|||||||:|||.:|:|:..    |||:|:||..::.|.|:::|:| ..|
Mouse   132 HWTTEDGFEMQFGVNYLGHFLLTNLLLDKLKASAP----SRIINLSSLAHVAGHIDFEDLNWQMK 192

  Fly   226 HYYPGTAYSQSKLAQILFTRHLQTLLDAEKSHVQVNVVHPGIVDTDLFEH-----SATTSVPI-- 283
            .|....||.|||||.:|||:.|...|  :.|.|.||.:|||:..|:|..|     ||.:...:  
Mouse   193 KYDTKAAYCQSKLAVVLFTKELSHRL--QGSGVTVNALHPGVARTELGRHTGMHNSAFSGFMLGP 255

  Fly   284 FKKLFFKTPERGSRTVVFAAIDPSIEGQGGTYLSNGGKGPFHPDAKKPAKCEQLFQFSCDLL 345
            |..|.||:|:..::...:.|:...:|...|.|.....:....|:|:......:|:..|..|:
Mouse   256 FFWLLFKSPQLAAQPSTYLAVAEELENVSGKYFDGLREKAPSPEAEDEEVARRLWTESARLV 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 101/306 (33%)
NADB_Rossmann 67..338 CDD:304358 95/283 (34%)
Rdh13NP_780581.1 NADB_Rossmann 38..313 CDD:419666 96/286 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.