DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and LOC100497142

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_002932135.3 Gene:LOC100497142 / 100497142 -ID:- Length:352 Species:Xenopus tropicalis


Alignment Length:296 Identity:85/296 - (28%)
Similarity:146/296 - (49%) Gaps:27/296 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 RDRVALYKQPDRI----AVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASI----VD 113
            |.||.|  .|.|:    .:||||..|||......|......|::...|.:..:||:..|    |.
 Frog    54 RKRVCL--DPKRLDGKTVLITGGTSGIGKETAIALAKRGARVIITNEDEEKGDTALRQIKRESVS 116

  Fly   114 LNATKGKLICEQLDVGDLKSVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFL 178
            :|.   |::  :|::.:|:|::.|.:...::..::|:|:||||:. |....|.:|:...|.:|.|
 Frog   117 MNV---KIM--KLNMANLQSIREFCKDFVQKEKRLDILINNAGVP-AVLDWTDNGFSMCFGVNHL 175

  Fly   179 GHFLLTHLLLPQLRAAGKEGRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILF 243
            |.||||.||..:|::...    ||::.|:|.|:...|:::.|:|  .:..|..:|.:||||.:.|
 Frog   176 GTFLLTSLLTERLKSCSP----SRVITVTSEVHKYQRLDFADLN--YNIVPLFSYCRSKLANVYF 234

  Fly   244 TRHLQTLLDAEKSHVQVNVVHPGIVD---TDLFEHSATTSVPIFKKLFFKTPERGSRTVVFAAID 305
            |:.|...:  |:..|....||||.|.   |..|.......:.:...:||.:...|:::|:..|:.
 Frog   235 TQELARQI--ERHGVTSCAVHPGYVVGDWTSKFSVLFRIVMYVISSMFFISCLEGAQSVIHCAVS 297

  Fly   306 PSIEGQGGTYLSNGGKGPFHPDAKKPAKCEQLFQFS 341
            ..|....|.|.|:.......|.|:.....::|::.|
 Frog   298 DDILQHNGGYFSDCKPCKLRPHAQDTGIAKKLWEVS 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 85/296 (29%)
NADB_Rossmann 67..338 CDD:304358 78/281 (28%)
LOC100497142XP_002932135.3 AraJ 11..>59 CDD:225371 3/4 (75%)
NADB_Rossmann 66..333 CDD:419666 78/280 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.