DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and dhrsx

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_002933664.3 Gene:dhrsx / 100487450 XenbaseID:XB-GENE-5952439 Length:327 Species:Xenopus tropicalis


Alignment Length:293 Identity:109/293 - (37%)
Similarity:172/293 - (58%) Gaps:18/293 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 QPDRIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASI-VDLNATKGK-LICEQLD 127
            |..::|::|||.:|||....:.|.:..|.|::...:......||..| .|.:..|.: |.|   |
 Frog    39 QNGKVAIVTGGAKGIGYSTAKHLSSLGMHVIIAGNNEAEGSEAVTRIQQDTHNEKVEFLYC---D 100

  Fly   128 VGDLKSVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLR 192
            :..:||::.|.|:.|.:...:.:|:||||:|..|.:.||||:|.||.:|:|||||||:|||...:
 Frog   101 LASMKSIRQFVQIFKAKNLCLHVLVNNAGVMLVPERKTADGFEEHFGLNYLGHFLLTNLLLKTTK 165

  Fly   193 AAGKEGRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTLLDAEKSH 257
            .:|.|..|:||:.|||..:.:|.:|:.|:|.:..|.|..||:|||||.::||.:||..|..:..:
 Frog   166 ESGTENLNARIITVSSATHYVGELNFDDLNSSCCYSPHGAYAQSKLALVMFTYYLQRQLSEDGCY 230

  Fly   258 VQVNVVHPGIVDTDLFEHSATTSVPI---FKKLFFKTPERGSRTVVFAAIDPSIEGQGGTYLSNG 319
            |..|||.||:|:|||:.:.......:   ..:|||||.|.|:.|.::|::.|.:||.||.||.||
 Frog   231 VTANVVDPGVVNTDLYRNVCWPGRLVKWMAARLFFKTAEEGAATSIYASVAPELEGIGGCYLYNG 295

  Fly   320 GKG-----PFHPDAKKPAKCEQLFQFSCDLLKI 347
            .|.     .::.|.::     :|:..||.::.|
 Frog   296 QKTKSADISYNEDLQR-----KLWNESCKMVGI 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 108/288 (38%)
NADB_Rossmann 67..338 CDD:304358 104/280 (37%)
dhrsxXP_002933664.3 retinol-DH_like_SDR_c_like 41..314 CDD:212492 104/280 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H78041
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR24320
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X5858
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
77.010

Return to query results.
Submit another query.