DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and rdh11

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_031751072.1 Gene:rdh11 / 100485470 XenbaseID:XB-GENE-5943090 Length:327 Species:Xenopus tropicalis


Alignment Length:291 Identity:95/291 - (32%)
Similarity:142/291 - (48%) Gaps:38/291 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVGDLK 132
            :.|::||.|.|||..:...|...:..|::..|..:..:.|:..| ......|.::.|.||...:.
 Frog    43 KTAIVTGANTGIGKCVAMDLARRNARVILACRSRERGQRALEEI-RRQTGNGAVLLEMLDTSSMA 106

  Fly   133 SVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGKE 197
            ||:|||..|.::..::|:|:||||....|..:||:|.|:.||.|.||.||||:||...:|.:.. 
 Frog   107 SVRAFADRILQQEKRLDILINNAGASGLPHSMTAEGLENTFATNHLGPFLLTNLLTGLMRKSAP- 170

  Fly   198 GRNSRIVNVSSCVNLIGRINY-----KDINGTKHYYPGTAYSQSKLAQIL----FTRHLQTLLDA 253
               ||||.|||..:..|.|:.     ::|.|.:..||   |:.|||..|:    |.|.|:     
 Frog   171 ---SRIVFVSSFNHKNGEIHLSCLRGQNIRGFRPDYP---YNCSKLMNIMCANEFARRLR----- 224

  Fly   254 EKSHVQVNVVHPGIVDTDLFEHSATTSVPIFKKL---FFKTPERGSRTVVFAAIDPSIEGQGGTY 315
             .:.|.|..:.||||.|:...:.:.....|||.:   ||:|||.|:.:.:|.|:....||....|
 Frog   225 -GTGVTVTSLDPGIVMTEAVRYYSIFIRLIFKSIGFFFFRTPEEGAVSTIFCAVSEEAEGLTEKY 288

  Fly   316 L---------SNGGKGPFHP-DAKKPAKCEQ 336
            :         |...:.|  | .||....|||
 Frog   289 IDCDCMLALPSPAARDP--PVTAKLWEACEQ 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 95/291 (33%)
NADB_Rossmann 67..338 CDD:304358 95/291 (33%)
rdh11XP_031751072.1 NADB_Rossmann 42..313 CDD:419666 92/285 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.