DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and dhrs12lb

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_002660947.2 Gene:dhrs12lb / 100334077 ZFINID:ZDB-GENE-131121-6 Length:345 Species:Danio rerio


Alignment Length:307 Identity:81/307 - (26%)
Similarity:148/307 - (48%) Gaps:52/307 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LLWIFFVGLLLCAFLFSKTTKEFPKSWFEWKTEFRYQYLGIVGLVHDAQYKARD-RVALYKQPDR 68
            :||            |.|..:|:.:|.||..::               .:.|:| .|::.   .|
Zfish    27 ILW------------FIKGMREYTRSGFENASK---------------SFAAKDLDVSMV---GR 61

  Fly    69 IAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVGDLKS 133
            ..:|||.|.|||......:.....||.:..|:.:.||.|...||..:... .:....||:.:.:.
Zfish    62 SFMITGANSGIGKATAMAIAKKGGTVHIVCRNKEKAERAREEIVSASGNT-MVFVHVLDLSESRK 125

  Fly   134 VKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGKEG 198
            |..||:..|:.::.:::|:||||.|....::.:||.|.:||.|.||.::||..|:|.|    ::.
Zfish   126 VWEFAEAFKKEHTSLNVLINNAGCMVNQREINSDGLEKNFATNTLGVYILTKCLIPLL----EKS 186

  Fly   199 RNSRIVNVSSCVNLIGRINYKDINGTKHYYPGT-AYSQSKLAQILFTRHLQTLLDAEKSH--VQV 260
            |:.|::.|||...|:.::|..|:...:..:..| .|:|:|..|::.|...      .|::  :..
Zfish   187 RDPRVITVSSGGMLVQKLNPDDLQTERAQFDATMVYAQNKRQQVVMTEFW------AKAYPKIHF 245

  Fly   261 NVVHPGIVDTDLFEHSATTSVPIFKKLF---FKTPERGSRTVVFAAI 304
            :|:|||..||.    :..:::|.|.:|.   .::.|:||.|:::.|:
Zfish   246 SVMHPGWADTP----AVASAMPQFYQLMRDRLRSAEQGSDTLIWLAM 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 73/256 (29%)
NADB_Rossmann 67..338 CDD:304358 70/244 (29%)
dhrs12lbXP_002660947.2 SDR 60..314 CDD:330230 70/244 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1208
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.