DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and si:dkey-73n8.3

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:NP_001186991.1 Gene:si:dkey-73n8.3 / 100150965 ZFINID:ZDB-GENE-141219-27 Length:296 Species:Danio rerio


Alignment Length:284 Identity:108/284 - (38%)
Similarity:157/284 - (55%) Gaps:13/284 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 RIAVITGGNRGIGLRIVEKLLACDMTVVMGVRDPKIAETAVASIVDLNATKGKLICEQLDVGDLK 132
            :.|::||.|.|||....:.|......|::..||...||.| ||.:..:.....::..:||:.|.|
Zfish    21 KTAIVTGANTGIGKETAKDLANRGARVILACRDLVKAEQA-ASDISRDVENANVVVRKLDLADTK 84

  Fly   133 SVKAFAQLIKERYSKVDLLLNNAGIMFAPFKLTADGYESHFAINFLGHFLLTHLLLPQLRAAGKE 197
            |:..||:||......:.||:||||:...|:..|.||:|:.|.:|.||||.||.||:..|    |.
Zfish    85 SICEFAELIYNTEKSLHLLINNAGVAICPYSTTVDGFETQFGVNHLGHFFLTFLLIDLL----KH 145

  Fly   198 GRNSRIVNVSSCVNLIGRINYKDINGTKHYYPGTAYSQSKLAQILFTRHLQTLLDAEKSHVQVNV 262
            ...||::||||.|:.:|:|:::|:|..|:|:|..||.|||||.|||||.|.:.:  |:..|:|..
Zfish   146 SAPSRVINVSSLVHPMGKIHFEDLNSEKNYHPVKAYVQSKLANILFTRELASRV--EELGVRVYA 208

  Fly   263 VHPGIVDTDLFEHSATTSVPIFKKLF---FKTPERGSRTVVFAAIDPSIEGQGGTYLSNGGKGPF 324
            |.||:|:||:..| ....|..|.|.|   .|||..|:.|.::.|:.|.:  ..|:|.||......
Zfish   209 VDPGLVNTDITRH-LMKPVQFFVKTFGFMIKTPAEGAYTTLYCALTPDL--PTGSYYSNCAVASC 270

  Fly   325 HPDAKKPAKCEQLFQFSCDLLKIQ 348
            ...||......:|:..||.||.|:
Zfish   271 SRAAKDDNSASKLWAVSCHLLGIR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 105/278 (38%)
NADB_Rossmann 67..338 CDD:304358 102/272 (38%)
si:dkey-73n8.3NP_001186991.1 PRK06197 19..295 CDD:235737 108/284 (38%)
NADB_Rossmann 20..287 CDD:304358 103/275 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.