DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG11200 and wwox

DIOPT Version :9

Sequence 1:NP_001286630.1 Gene:CG11200 / 37301 FlyBaseID:FBgn0034500 Length:355 Species:Drosophila melanogaster
Sequence 2:XP_017948987.1 Gene:wwox / 100145151 XenbaseID:XB-GENE-5721345 Length:414 Species:Xenopus tropicalis


Alignment Length:362 Identity:100/362 - (27%)
Similarity:154/362 - (42%) Gaps:64/362 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 WIFFVGLLLCAFLFSKTTKEFPKSW----------FEWKTEF--------------RYQYLG--I 45
            |:::..     .|..||..|.||:.          :.|:.|.              |..||.  :
 Frog    31 WVYYAN-----HLDEKTQWEHPKTGKRKRIAGDLPYGWEQETDENGQIYFVDHLNQRTTYLDPRL 90

  Fly    46 VGLVHDAQYKARDR---------VALYKQPD---RIAVITGGNRGIGLRIVEKLLACDMTVVMGV 98
            ...|.|...|...|         :.:.:..|   ::.::||.|.|||......|......|::..
 Frog    91 AFTVEDQPTKMNTRQKYDGNTTAMEILQGCDLSGKVVIVTGANTGIGFETARSLALHGTLVILAC 155

  Fly    99 RDPKIAETAVASIVDLNATKGKLICEQLDVGDLKSVKAFAQLIKERYSKVDLLLNNAGIMFAPFK 163
            |:.:....|...|:: ...|.|:....||:..|:||::||:..|.|...:.:|:.||..:..|::
 Frog   156 RNLQKGNEAKHKILE-EWHKAKVEVMSLDLASLRSVQSFAEAFKSRNLALHVLICNAAYLGGPWQ 219

  Fly   164 LTADGYESHFAINFLGHFLLTHLLLPQLRAAGKEGRNSRIVNVSSCVNLIGRINYKDING----- 223
            ||.||.|..|.:|.||||.|..||...|    :....||:|.|||..:....|  ||.:|     
 Frog   220 LTEDGLEMTFQVNHLGHFYLVSLLQDVL----QRSIPSRVVVVSSESHRFTEI--KDSSGKLDLN 278

  Fly   224 -----TKHYYPGTAYSQSKLAQILFTRHLQTLLDAEKSHVQVNVVHPGIVDTDLFEHS--ATTSV 281
                 .|.|:...||::|||..|||::.|...|...  .|..|.||||.:.......:  ..|.:
 Frog   279 LLSPLKKDYWAMLAYNRSKLCNILFSKELNRRLSPH--GVTSNAVHPGNMMYSSIHRNWWGYTLL 341

  Fly   282 PIFKKLFFKTPERGSRTVVFAAIDPSIEGQGGTYLSN 318
            ....:.|.|:.::|:.|.|:.|:.|.:||.||.|.:|
 Frog   342 FALVRPFTKSMQQGASTSVYCAVSPELEGLGGMYFNN 378

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG11200NP_001286630.1 PRK06196 56..344 CDD:235736 85/287 (30%)
NADB_Rossmann 67..338 CDD:304358 84/267 (31%)
wwoxXP_017948987.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000061
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.