DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIIbeta2 and CKB1

DIOPT Version :9

Sequence 1:NP_477407.1 Gene:CkIIbeta2 / 37300 FlyBaseID:FBgn0026136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_011496.3 Gene:CKB1 / 852865 SGDID:S000002987 Length:278 Species:Saccharomyces cerevisiae


Alignment Length:233 Identity:90/233 - (38%)
Similarity:134/233 - (57%) Gaps:40/233 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TDSDESS-----WIHWFCKQRGNEFFCEVDEEYIQDKFNLNFLDSNVKNYKCALEVILDLNPGS- 60
            :..||.|     ||..||.:.|:|:||:|..|:|:|.||:..|...|.:|:.||::||||...| 
Yeast    14 SSDDEDSGAYDEWIPSFCSRFGHEYFCQVPTEFIEDDFNMTSLSQEVPHYRKALDLILDLEAMSD 78

  Fly    61 --------ASEDPAEPE-----------------------LEASAEKLYGLIHARFILTNRGIEL 94
                    ..||..:.|                       :|.:||:||||||||||||..|::.
Yeast    79 EEEDEDDVVEEDEVDQEMQSNDGHDEGKRRNKSPVVNKSIIEHAAEQLYGLIHARFILTKPGLQA 143

  Fly    95 MLDKYNKGEFGTCPRAFCHSQPVLPIGLSDNPGEDMVRIYCPKCNDVYIPKASRHSNLDGAFFGT 159
            |.:|::..|||||||.:|:...:||.||||..|:..||:|||.|.|:|:|::||...|:|||:||
Yeast   144 MAEKFDHKEFGTCPRYYCNGMQLLPCGLSDTVGKHTVRLYCPSCQDLYLPQSSRFLCLEGAFWGT 208

  Fly   160 GFPHMF---FMEKPDARPKRAKQKFVPRLYGFKIHPTA 194
            .||.:|   |.|..:...:::|:.:..:::||:|:..|
Yeast   209 SFPGVFLKHFKELEEYVERKSKESYELKVFGFRINDEA 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIIbeta2NP_477407.1 CK_II_beta 9..189 CDD:279546 84/214 (39%)
CKB1NP_011496.3 SKB2 1..278 CDD:227374 90/233 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343659
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.772836 Normalized mean entropy S292
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001997
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100687
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
76.550

Return to query results.
Submit another query.