DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIIbeta2 and CKB1

DIOPT Version :9

Sequence 1:NP_477407.1 Gene:CkIIbeta2 / 37300 FlyBaseID:FBgn0026136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_199519.1 Gene:CKB1 / 834754 AraportID:AT5G47080 Length:287 Species:Arabidopsis thaliana


Alignment Length:192 Identity:99/192 - (51%)
Similarity:134/192 - (69%) Gaps:2/192 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TDSDESSWIHWFCKQRGNEFFCEVDEEYIQDKFNLNFLDSNVKNYKCALEVILDL--NPGSASED 64
            :|.:::|||.|||..||||||||||::||||.|||..|.|.|..|:.||::|||:  :.|....:
plant    94 SDGEDTSWISWFCNLRGNEFFCEVDDDYIQDDFNLCGLSSLVPYYEYALDLILDVESSQGEMFTE 158

  Fly    65 PAEPELEASAEKLYGLIHARFILTNRGIELMLDKYNKGEFGTCPRAFCHSQPVLPIGLSDNPGED 129
            .....:|::||.||||||||:|||::|:..|||||...:||.|||.:|..||.||:|.||.|...
plant   159 EQNELIESAAEMLYGLIHARYILTSKGLAAMLDKYKNYDFGRCPRVYCCGQPCLPVGQSDLPRSS 223

  Fly   130 MVRIYCPKCNDVYIPKASRHSNLDGAFFGTGFPHMFFMEKPDARPKRAKQKFVPRLYGFKIH 191
            .|:||||||.|:|.|::....|:|||:|||.|||:|.|.....:|.:|.|.:|.|::|||:|
plant   224 TVKIYCPKCEDIYYPRSKYQGNIDGAYFGTTFPHLFLMTYGHLKPAKATQNYVQRVFGFKLH 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIIbeta2NP_477407.1 CK_II_beta 9..189 CDD:279546 94/181 (52%)
CKB1NP_199519.1 CK_II_beta 100..283 CDD:395970 95/182 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 237 1.000 Domainoid score I608
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 245 1.000 Inparanoid score I1054
OMA 1 1.010 - - QHG53662
OrthoDB 1 1.010 - - D1335521at2759
OrthoFinder 1 1.000 - - FOG0001997
OrthoInspector 1 1.000 - - mtm1021
orthoMCL 1 0.900 - - OOG6_100687
Panther 1 1.100 - - O PTHR11740
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1673
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.