DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIIbeta2 and CKB3

DIOPT Version :9

Sequence 1:NP_477407.1 Gene:CkIIbeta2 / 37300 FlyBaseID:FBgn0026136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_191584.1 Gene:CKB3 / 825196 AraportID:AT3G60250 Length:276 Species:Arabidopsis thaliana


Alignment Length:193 Identity:96/193 - (49%)
Similarity:131/193 - (67%) Gaps:4/193 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 TDSDESSWIHWFCKQRGNEFFCEVDEEYIQDKFNLNFLDSNVKNYKCALEVILDLNPGSASE--- 63
            ::.|::|||.|||..|||:|||||||:||||.|||..|...|..|..||::|||:: .|.||   
plant    83 SEGDDTSWISWFCNLRGNDFFCEVDEDYIQDDFNLCGLSGQVPYYDYALDLILDVD-ASNSEMFT 146

  Fly    64 DPAEPELEASAEKLYGLIHARFILTNRGIELMLDKYNKGEFGTCPRAFCHSQPVLPIGLSDNPGE 128
            |.....:|::||.||||||.|:|||.:|:..|.:||...:||.|||.||..|..||:|.||.|..
plant   147 DEQHEMVESAAEMLYGLIHVRYILTTKGMAAMTEKYKNCDFGRCPRVFCCGQSCLPVGQSDIPRS 211

  Fly   129 DMVRIYCPKCNDVYIPKASRHSNLDGAFFGTGFPHMFFMEKPDARPKRAKQKFVPRLYGFKIH 191
            ..|:||||||.|:..|::....|:|||:|||.|||:|.|...:.:|::..|.:||:::|||:|
plant   212 STVKIYCPKCEDISYPRSKFQGNIDGAYFGTTFPHLFLMTYGNLKPQKPTQSYVPKIFGFKVH 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIIbeta2NP_477407.1 CK_II_beta 9..189 CDD:279546 91/182 (50%)
CKB3NP_191584.1 CK_II_beta 89..272 CDD:395970 92/183 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 237 1.000 Domainoid score I608
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 245 1.000 Inparanoid score I1054
OMA 1 1.010 - - QHG53662
OrthoDB 1 1.010 - - D1335521at2759
OrthoFinder 1 1.000 - - FOG0001997
OrthoInspector 1 1.000 - - mtm1021
orthoMCL 1 0.900 - - OOG6_100687
Panther 1 1.100 - - O PTHR11740
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1673
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.