DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIIbeta2 and CG40635

DIOPT Version :9

Sequence 1:NP_477407.1 Gene:CkIIbeta2 / 37300 FlyBaseID:FBgn0026136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001104166.2 Gene:CG40635 / 5740827 FlyBaseID:FBgn0085506 Length:88 Species:Drosophila melanogaster


Alignment Length:86 Identity:34/86 - (39%)
Similarity:46/86 - (53%) Gaps:9/86 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 ESSWIHWFCKQRGNEFFCEVDEEYIQDKFNLNFLDSNVKNYKCALEVILDLNPGSASEDPAEPEL 70
            :||||..|...:||||.|.|..:||||.||...|:...:.....|.::.|.:....|.|      
  Fly    12 DSSWISSFLGIKGNEFLCRVPIDYIQDPFNRTGLELFPQTLDVFLNLVFDRSTDWVSGD------ 70

  Fly    71 EASAEKLYGLIHARFILTNRG 91
               .|||||:||||:|::.||
  Fly    71 ---EEKLYGMIHARYIVSKRG 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIIbeta2NP_477407.1 CK_II_beta 9..189 CDD:279546 32/83 (39%)
CG40635NP_001104166.2 CK_II_beta 15..>88 CDD:295171 30/81 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448628
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.830

Return to query results.
Submit another query.