DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIIbeta2 and csnk2b

DIOPT Version :9

Sequence 1:NP_477407.1 Gene:CkIIbeta2 / 37300 FlyBaseID:FBgn0026136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001005081.1 Gene:csnk2b / 448656 XenbaseID:XB-GENE-487924 Length:215 Species:Xenopus tropicalis


Alignment Length:198 Identity:130/198 - (65%)
Similarity:156/198 - (78%) Gaps:2/198 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTDSDESSWIHWFCKQRGNEFFCEVDEEYIQDKFNLNFLDSNVKNYKCALEVILDLNPGSASED- 64
            |:.|:|.|||.|||..|||||||||||:||||||||..|:..|.:|:.||::||||.|....|| 
 Frog     1 MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDN 65

  Fly    65 PAEPEL-EASAEKLYGLIHARFILTNRGIELMLDKYNKGEFGTCPRAFCHSQPVLPIGLSDNPGE 128
            |.:.:| |.:||.||||||||:|||||||..||:||.:|:||.|||.:|.:||:|||||||.|||
 Frog    66 PNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGE 130

  Fly   129 DMVRIYCPKCNDVYIPKASRHSNLDGAFFGTGFPHMFFMEKPDARPKRAKQKFVPRLYGFKIHPT 193
            .||::|||||.|||.||:|||.:.|||:||||||||.||..|:.||||...:||||||||||||.
 Frog   131 AMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPM 195

  Fly   194 AYR 196
            ||:
 Frog   196 AYQ 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIIbeta2NP_477407.1 CK_II_beta 9..189 CDD:279546 119/181 (66%)
csnk2bNP_001005081.1 CK_II_beta 8..191 CDD:198153 120/182 (66%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53662
OrthoDB 1 1.010 - - D1335521at2759
OrthoFinder 1 1.000 - - FOG0001997
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11740
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1673
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.