DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIIbeta2 and Ste:CG33242

DIOPT Version :9

Sequence 1:NP_477407.1 Gene:CkIIbeta2 / 37300 FlyBaseID:FBgn0026136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_996426.2 Gene:Ste:CG33242 / 2768898 FlyBaseID:FBgn0053242 Length:171 Species:Drosophila melanogaster


Alignment Length:162 Identity:58/162 - (35%)
Similarity:87/162 - (53%) Gaps:25/162 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 RGNEFFCEVDEEYIQDKFNLNFLDSNVKNYKCALEVILDLNPGSASEDPAEPELEASA------- 74
            |.....|.|..:|:||.||    ...::.:...|:|||            :|.:::|:       
  Fly    18 RATSSSCRVPTDYVQDTFN----QMGLEYFSEILDVIL------------KPVIDSSSGLLYGDE 66

  Fly    75 EKLYGLIHARFILTNRGIELMLDKYNKGEFGTCPRAFCHSQPVLPIGLSDNPGEDMVRIYCPKCN 139
            :|.||:||||:|.:.||:..|..||.:|:||:||...|..|..||:|||...|:..|:|:||:|.
  Fly    67 KKWYGMIHARYIRSERGLIAMHRKYMRGDFGSCPNISCDRQNTLPVGLSAVWGKSTVKIHCPRCK 131

  Fly   140 DVYIPKASRHSNLDGAFFGTGFPHMFFMEKPD 171
            ..:.||:.  :.||||.||..||.:||...|:
  Fly   132 SNFHPKSD--TQLDGAMFGPSFPDIFFSMLPN 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIIbeta2NP_477407.1 CK_II_beta 9..189 CDD:279546 58/162 (36%)
Ste:CG33242NP_996426.2 CK_II_beta 24..165 CDD:198153 57/156 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45448634
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.772836 Normalized mean entropy S292
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1335521at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11740
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.