DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CkIIbeta2 and CSNK2B

DIOPT Version :9

Sequence 1:NP_477407.1 Gene:CkIIbeta2 / 37300 FlyBaseID:FBgn0026136 Length:219 Species:Drosophila melanogaster
Sequence 2:NP_001311.3 Gene:CSNK2B / 1460 HGNCID:2460 Length:215 Species:Homo sapiens


Alignment Length:198 Identity:130/198 - (65%)
Similarity:156/198 - (78%) Gaps:2/198 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTDSDESSWIHWFCKQRGNEFFCEVDEEYIQDKFNLNFLDSNVKNYKCALEVILDLNPGSASED- 64
            |:.|:|.|||.|||..|||||||||||:||||||||..|:..|.:|:.||::||||.|....|| 
Human     1 MSSSEEVSWISWFCGLRGNEFFCEVDEDYIQDKFNLTGLNEQVPHYRQALDMILDLEPDEELEDN 65

  Fly    65 PAEPEL-EASAEKLYGLIHARFILTNRGIELMLDKYNKGEFGTCPRAFCHSQPVLPIGLSDNPGE 128
            |.:.:| |.:||.||||||||:|||||||..||:||.:|:||.|||.:|.:||:|||||||.|||
Human    66 PNQSDLIEQAAEMLYGLIHARYILTNRGIAQMLEKYQQGDFGYCPRVYCENQPMLPIGLSDIPGE 130

  Fly   129 DMVRIYCPKCNDVYIPKASRHSNLDGAFFGTGFPHMFFMEKPDARPKRAKQKFVPRLYGFKIHPT 193
            .||::|||||.|||.||:|||.:.|||:||||||||.||..|:.||||...:||||||||||||.
Human   131 AMVKLYCPKCMDVYTPKSSRHHHTDGAYFGTGFPHMLFMVHPEYRPKRPANQFVPRLYGFKIHPM 195

  Fly   194 AYR 196
            ||:
Human   196 AYQ 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CkIIbeta2NP_477407.1 CK_II_beta 9..189 CDD:279546 119/181 (66%)
CSNK2BNP_001311.3 CK_II_beta 8..191 CDD:198153 120/182 (66%)
Interaction with alpha subunit. /evidence=ECO:0000250 188..193 4/4 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5041
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53662
OrthoDB 1 1.010 - - D1335521at2759
OrthoFinder 1 1.000 - - FOG0001997
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100687
Panther 1 1.100 - - O PTHR11740
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1673
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.