DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr56F and LOC4578367

DIOPT Version :10

Sequence 1:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster
Sequence 2:XP_001238133.1 Gene:LOC4578367 / 4578367 VectorBaseID:AGAMI1_005911 Length:187 Species:Anopheles gambiae


Alignment Length:69 Identity:27/69 - (39%)
Similarity:38/69 - (55%) Gaps:3/69 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 DEEQYGPAKYEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEYEA-DQNGYRPT 182
            ||:.  .|:|:|.|.|.|..:|:.....|||.||...|:|.::..||.|:.|||.| |.||:...
Mosquito    67 DEDH--DAQYDFSYGVHDDHTGDIKEQRESRHGDQVHGQYSLIDSDGHKRTVEYTADDHNGFNAV 129

  Fly   183 IRYE 186
            :..|
Mosquito   130 VHRE 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:459790 22/51 (43%)
LOC4578367XP_001238133.1 Chitin_bind_4 74..126 CDD:459790 22/51 (43%)

Return to query results.
Submit another query.