DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr56F and Ccp84Ab

DIOPT Version :9

Sequence 1:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_649682.1 Gene:Ccp84Ab / 40824 FlyBaseID:FBgn0004782 Length:221 Species:Drosophila melanogaster


Alignment Length:125 Identity:37/125 - (29%)
Similarity:53/125 - (42%) Gaps:36/125 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 APIAPPQGQYGAPALT-----------GAIFKGGNGNGNGGYGGGNGNGNGYGQRDEEQYGP-AK 127
            ||||.||..:.|||:.           ..:.|..                       |:|.| .:
  Fly    20 APIAAPQVYHAAPAVATYAHAPVAVAQKVVVKAA-----------------------EEYDPHPQ 61

  Fly   128 YEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEYEADQ-NGYRPTIRYE 186
            |.|.|.|.|..:|::.|.:|.||||:..|.|.::..||.|:.|:|.||. ||:...:..|
  Fly    62 YRFSYGVDDKLTGDNKGQVEERDGDVVRGEYSLIDADGYKRTVQYTADPINGFNAVVNRE 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:278791 22/51 (43%)
Ccp84AbNP_649682.1 Chitin_bind_4 62..114 CDD:278791 22/51 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.