DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr56F and Cpr76Bd

DIOPT Version :10

Sequence 1:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster


Alignment Length:213 Identity:50/213 - (23%)
Similarity:72/213 - (33%) Gaps:86/213 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PQRAGGNGGAPSNSYGAPI-------APPQGQYGA---------PALT-GAIFKGGNGNGNG--- 103
            |..|.|...|.|.:||...       .|..|.|||         |||: ..:...|:|..:|   
  Fly  1017 PAYALGGKLASSTAYGIQAGNLGHGSGPSGGYYGAISLGHAKVSPALSYHGLLSHGSGLASGASS 1081

  Fly   104 ---------GYGGGNGN----GNGYGQRDEEQYGPA----------------------------- 126
                     ||..|.|.    |.|:     .:|.|:                             
  Fly  1082 LAHLDSSLSGYSHGVGGIGPLGAGF-----YRYAPSVPALSSHAPVAATAYLKSAPVTQHAVLKV 1141

  Fly   127 -------------KYEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEYEAD-QN 177
                         :|.|:|.|.|..:|::....|.||||:..|.|.::.|||..:.|:|.|| :.
  Fly  1142 VPEKHLEHFDAHPRYAFEYAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWET 1206

  Fly   178 GYRPTIRYEQVGNGNGNG 195
            |:     :.:|.|....|
  Fly  1207 GF-----HAEVINSRDQG 1219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:459790 20/51 (39%)
Cpr76BdNP_001262052.1 2A1904 130..>270 CDD:273344
PRK07003 <456..>610 CDD:235906
Chitin_bind_4 1156..1208 CDD:459790 20/51 (39%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.