DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr56F and Cpr76Bd

DIOPT Version :9

Sequence 1:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_001262052.1 Gene:Cpr76Bd / 40123 FlyBaseID:FBgn0036881 Length:1231 Species:Drosophila melanogaster


Alignment Length:213 Identity:50/213 - (23%)
Similarity:72/213 - (33%) Gaps:86/213 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    59 PQRAGGNGGAPSNSYGAPI-------APPQGQYGA---------PALT-GAIFKGGNGNGNG--- 103
            |..|.|...|.|.:||...       .|..|.|||         |||: ..:...|:|..:|   
  Fly  1017 PAYALGGKLASSTAYGIQAGNLGHGSGPSGGYYGAISLGHAKVSPALSYHGLLSHGSGLASGASS 1081

  Fly   104 ---------GYGGGNGN----GNGYGQRDEEQYGPA----------------------------- 126
                     ||..|.|.    |.|:     .:|.|:                             
  Fly  1082 LAHLDSSLSGYSHGVGGIGPLGAGF-----YRYAPSVPALSSHAPVAATAYLKSAPVTQHAVLKV 1141

  Fly   127 -------------KYEFKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEYEAD-QN 177
                         :|.|:|.|.|..:|::....|.||||:..|.|.::.|||..:.|:|.|| :.
  Fly  1142 VPEKHLEHFDAHPRYAFEYAVNDPHTGDNKHQKEERDGDVVKGEYSLVEPDGNVRTVKYYADWET 1206

  Fly   178 GYRPTIRYEQVGNGNGNG 195
            |:     :.:|.|....|
  Fly  1207 GF-----HAEVINSRDQG 1219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:278791 20/51 (39%)
Cpr76BdNP_001262052.1 Chitin_bind_4 1156..1208 CDD:278791 20/51 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.