DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr56F and resilin

DIOPT Version :9

Sequence 1:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_611157.1 Gene:resilin / 36880 FlyBaseID:FBgn0034157 Length:620 Species:Drosophila melanogaster


Alignment Length:228 Identity:102/228 - (44%)
Similarity:114/228 - (50%) Gaps:50/228 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 PQNQYLPPNQSPQA----PSNNYLPPTQGYQSPSSNYLPPQRAGGNGGAPSNSYGAPIAPPQGQ- 83
            |.:.|..|.|....    ||::|..|.|. |.||.:|..|....||||.||:|||||.:.|.|: 
  Fly   248 PSSSYGAPGQGQGGFGGRPSDSYGAPGQN-QKPSDSYGAPGSGNGNGGRPSSSYGAPGSGPGGRP 311

  Fly    84 ---YGAPALTGAIFKGGNGNGNGGYGGGNGNGNGYGQRDEEQYGPAKYEFKYDVQDYESGNDFGH 145
               ||.||         :|:|.||.||....|..| ..||    ||||||.|.|:|..||..|||
  Fly   312 SDSYGPPA---------SGSGAGGAGGSGPGGADY-DNDE----PAKYEFNYQVEDAPSGLSFGH 362

  Fly   146 MESRDGDLAVGRYYVLLPDGRKQIVEYEADQNGYRPTIRYEQVGN-------------------- 190
            .|.||||...|:|.|||||||||||||||||.||||.||||...|                    
  Fly   363 SEMRDGDFTTGQYNVLLPDGRKQIVEYEADQQGYRPQIRYEGDANDGSGPSGPGGPGGQNLGADG 427

  Fly   191 ------GNGNGNGNGRNGGGYDSNAQQGKFNGY 217
                  |||||||||...||.......|. :||
  Fly   428 YSSGRPGNGNGNGNGGYSGGRPGGQDLGP-SGY 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:278791 35/50 (70%)
resilinNP_611157.1 Chitin_bind_4 345..396 CDD:278791 35/50 (70%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CF9B
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0016575
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.