DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr56F and Cpr50Cb

DIOPT Version :9

Sequence 1:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_610901.1 Gene:Cpr50Cb / 36525 FlyBaseID:FBgn0033869 Length:178 Species:Drosophila melanogaster


Alignment Length:216 Identity:70/216 - (32%)
Similarity:92/216 - (42%) Gaps:56/216 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KAFTSIAL-LVCLAAWTHAEPPVPQNQYLPPNQSPQAPSNNYLPPTQGYQSPSSNYLPPQRAGGN 65
            |:|..::| |..::|:.:|:.....|.||||.:      |.|     .|..|.:.:.|     |.
  Fly     5 KSFVLLSLSLAAISAYAYAQIAPGSNAYLPPTK------NGY-----DYSEPKTPFKP-----GP 53

  Fly    66 GGAPSNSYGAPIAPPQGQYGAPALTGAIFKGGNGNGNGGYGGGNGNGNGYGQRDEEQYGPA-KYE 129
            .|.|:.....|.|||    |.|.         |..|..|              |:..:.|. .|:
  Fly    54 PGRPAAPGPRPPAPP----GTPR---------NIPGQPG--------------DDHVHVPGMPYD 91

  Fly   130 FKYDVQDYESGNDFGHMESRDGDLAVGRYYVLLPDGRKQIVEYEAD-QNGYRPTIRYE------- 186
            |:|.|||.|:.||:.|..|.|||:..|.|.|.:||||.|||.|.|| :.||...:.||       
  Fly    92 FEYAVQDPETANDYAHKASSDGDVVTGEYRVQMPDGRTQIVRYTADWKTGYHADVSYEGEATYPQ 156

  Fly   187 --QVGNGNGNGNGNGRNGGGY 205
              |.|...|.|.|.| ..|||
  Fly   157 GPQPGARGGGGGGAG-GAGGY 176

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:278791 27/51 (53%)
Cpr50CbNP_610901.1 Chitin_bind_4 90..142 CDD:278791 27/51 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.