DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr56F and Cpr23B

DIOPT Version :9

Sequence 1:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_608718.1 Gene:Cpr23B / 33480 FlyBaseID:FBgn0031467 Length:302 Species:Drosophila melanogaster


Alignment Length:300 Identity:67/300 - (22%)
Similarity:104/300 - (34%) Gaps:104/300 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 AFTSIALLVCLAAWTHAEPPVPQNQYLPPNQSPQAPSNNYLPPTQGYQSPSSNYLPPQRAGGNGG 67
            |..|:|||    |.:.||....:.:....| |..:...::|   ..|.:||:|.|       |..
  Fly     7 ALLSLALL----ATSQAEYNYNEKEAKAAN-SASSSGEDFL---SDYHTPSNNAL-------NSE 56

  Fly    68 APSNSYGAPIAPPQGQYGAPALTGAIFKGGNGNGNGGYGGG-----------------NGNGNGY 115
            |..:.|.. :||.:.|:.|.:.|.:: :..|...|......                 |......
  Fly    57 ATPDGYDY-VAPARNQFTAGSRTASV-QASNLLQNAASAANAESVLLPSPLPVLRHEQNSEVVSS 119

  Fly   116 GQRDEEQ-------------------------YGPAKYEFKYDVQDYESGNDFGHMESRDGDLAV 155
            .|:.:||                         :.||.|.|.|.|.|..:|:...|.|:|||.:..
  Fly   120 TQQQQEQQTVQHQQSEPLVVSSVLRQHQEPEVFPPASYSFNYAVNDASTGDIKEHSETRDGYVVR 184

  Fly   156 GRYYVLLPDGRKQIVEYEADQ-NGY----------------------RPT--------------I 183
            |.|.::.|||.|:.|.|.||. :|:                      :||              |
  Fly   185 GFYSLIDPDGYKRTVTYTADDVHGFNAVVNRVPYALKAVVVPVAQVAQPTPFVARDERSKSVDVI 249

  Fly   184 R--------YEQVGNGNGNGNGNGRNGGGYDSNAQQGKFN 215
            |        .|.|.:|:|:.:|:....|..|:.|:....|
  Fly   250 RSSGAAAGASENVLSGSGSSSGSVSGSGVSDTFAEDSYAN 289

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:278791 21/51 (41%)
Cpr23BNP_608718.1 Chitin_bind_4 157..209 CDD:278791 21/51 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12236
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.