DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr56F and CG11584

DIOPT Version :9

Sequence 1:NP_611470.1 Gene:Cpr56F / 37299 FlyBaseID:FBgn0034499 Length:217 Species:Drosophila melanogaster
Sequence 2:NP_572941.1 Gene:CG11584 / 32363 FlyBaseID:FBgn0030541 Length:662 Species:Drosophila melanogaster


Alignment Length:102 Identity:29/102 - (28%)
Similarity:42/102 - (41%) Gaps:23/102 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KAFTSIALLVCLAAWTHAEP-PVPQNQYLPP-----NQSPQAPSNNYLP-PTQGYQSPS----SN 55
            :.:|:.|.:..:...|::.| ||.|.||...     .|:..||:....| ..|.|.:|:    ..
  Fly   240 QTYTAAAPVQAVQQLTYSAPAPVTQEQYYSAPASVVQQTSSAPAPAPAPVQEQFYSAPAPAIQQT 304

  Fly    56 YLPPQRAGGNGGAPS----NSYGAPIAPPQGQYGAPA 88
            |..|        ||:    .:|.||...||..|.|||
  Fly   305 YSAP--------APAPVVQQTYSAPAPAPQQTYSAPA 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr56FNP_611470.1 Chitin_bind_4 128..179 CDD:278791
CG11584NP_572941.1 rne <209..408 CDD:236766 29/102 (28%)
rne <329..539 CDD:236766 4/5 (80%)
TFIIA 475..>635 CDD:281188
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.