DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and PHT3;1

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_196908.1 Gene:PHT3;1 / 831252 AraportID:AT5G14040 Length:375 Species:Arabidopsis thaliana


Alignment Length:355 Identity:184/355 - (51%)
Similarity:231/355 - (65%) Gaps:23/355 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKSLFDAAQNSTF-KSPFTSVNCQSATPTSAPTSTAVVTPTLKDVAPRQLTRNHNIAAAAVAEG 64
            :...:.::..|:.| |||       |..|.|:|||              .::|.:.:.|:....|
plant    24 LLDQVLNSNSNAAFEKSP-------SPAPRSSPTS--------------MISRKNFLIASPTEPG 67

  Fly    65 DSCEFGSNHYFLLCGLGGIISCGSTHTMVVPLDLVKCRLQVDPAKYKSVFTGFRISLAEEGVRGL 129
            ...|..|..::..|..|||:|||.||..|.|||||||.:|:|||||||:.:||.|.|.|:||:|.
plant    68 KGIEMYSPAFYAACTFGGILSCGLTHMTVTPLDLVKCNMQIDPAKYKSISSGFGILLKEQGVKGF 132

  Fly   130 AKGWAPTFIGYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFADIALAPME 194
            .:||.||.:|||.||.||||.||.|||.|.|..|.|....|:|.:|||.|||||..|||||.|.|
plant   133 FRGWVPTLLGYSAQGACKFGFYEYFKKTYSDLAGPEYTAKYKTLIYLAGSASAEIIADIALCPFE 197

  Fly   195 AAKVKIQTTPGFAKTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLELLYKYV 259
            |.||::||.||||:.:.:..||....||....||||.|||.|||||||||||.||..:|::|||.
plant   198 AVKVRVQTQPGFARGMSDGFPKFIKSEGYGGLYKGLAPLWGRQIPYTMMKFASFETIVEMIYKYA 262

  Fly   260 VPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGASALDVAKQLGWSGLW-G 323
            :|.|:::|:||.||.|:||.||:|||||||||||||.:||.||.||||:..|..|::|..||: .
plant   263 IPNPKSECSKGLQLGVSFAGGYVAGVFCAIVSHPADNLVSFLNNAKGATVGDAVKKIGMVGLFTR 327

  Fly   324 GLVPRIVMIGTLTAAQWFIYDAVKVFLRMP 353
            ||..|||||||||.|||.:|||.|||:.:|
plant   328 GLPLRIVMIGTLTGAQWGLYDAFKVFVGLP 357

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 53/88 (60%)
Mito_carr <188..258 CDD:278578 40/69 (58%)
Mito_carr 273..350 CDD:278578 51/77 (66%)
PHT3;1NP_196908.1 Mito_carr 74..163 CDD:395101 53/88 (60%)
Mito_carr 172..261 CDD:395101 52/88 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 121 1.000 Domainoid score I1862
eggNOG 1 0.900 - - E1_KOG0767
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 362 1.000 Inparanoid score I582
OMA 1 1.010 - - QHG55239
OrthoDB 1 1.010 - - D963446at2759
OrthoFinder 1 1.000 - - FOG0001887
OrthoInspector 1 1.000 - - mtm1078
orthoMCL 1 0.900 - - OOG6_101022
Panther 1 1.100 - - O PTHR45671
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X1083
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.