DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and SLC25A3

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_005879.1 Gene:SLC25A3 / 5250 HGNCID:10989 Length:362 Species:Homo sapiens


Alignment Length:377 Identity:252/377 - (66%)
Similarity:301/377 - (79%) Gaps:22/377 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFKSLFDAAQNSTFKSPFTSV------NCQSATPTSAPTSTAVVTPTLKDVAPRQLTRNHNIAAA 59
            ||.|:...|:.:.|.:|...:      :.:|::|  .||.           .||   |..|:|||
Human     1 MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSP--GPTG-----------QPR---RPRNLAAA 49

  Fly    60 AVAEGDSCEFGSNHYFLLCGLGGIISCGSTHTMVVPLDLVKCRLQVDPAKYKSVFTGFRISLAEE 124
            ||.|..||::||..:|:|||||||||||:|||.:|||||||||:||||.|||.:|.||.::|.|:
Human    50 AVEEQYSCDYGSGRFFILCGLGGIISCGTTHTALVPLDLVKCRMQVDPQKYKGIFNGFSVTLKED 114

  Fly   125 GVRGLAKGWAPTFIGYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFADIA 189
            |||||||||||||:|||||||||||.|||||.:|.:.:||||.:|:||.||||||||||||||||
Human   115 GVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIA 179

  Fly   190 LAPMEAAKVKIQTTPGFAKTLREALPKMTAQEGVTAFYKGLVPLWMRQIPYTMMKFACFERTLEL 254
            |||||||||:|||.||:|.|||:|.|||..:||:.|||||:.||||||||||||||||||||:|.
Human   180 LAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEA 244

  Fly   255 LYKYVVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGASALDVAKQLGWS 319
            |||:||||||::|:|.|||||||.|||||||||||||||||:|||.||:.||:||..|.|:||:.
Human   245 LYKFVVPKPRSECSKPEQLVVTFVAGYIAGVFCAIVSHPADSVVSVLNKEKGSSASLVLKRLGFK 309

  Fly   320 GLWGGLVPRIVMIGTLTAAQWFIYDAVKVFLRMPRPPPPEMPESLKKKLGVT 371
            |:|.||..||:|||||||.||||||:|||:.|:|||||||||||||||||:|
Human   310 GVWKGLFARIIMIGTLTALQWFIYDSVKVYFRLPRPPPPEMPESLKKKLGLT 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 67/88 (76%)
Mito_carr <188..258 CDD:278578 54/69 (78%)
Mito_carr 273..350 CDD:278578 57/76 (75%)
SLC25A3NP_005879.1 Solcar 1 63..147 65/83 (78%)
Mito_carr 64..152 CDD:278578 66/87 (76%)
Solcar 2 160..244 67/83 (81%)
Mito_carr <178..247 CDD:278578 53/68 (78%)
Solcar 3 261..339 58/77 (75%)
Mito_carr 263..341 CDD:332982 57/77 (74%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143570
Domainoid 1 1.000 146 1.000 Domainoid score I4547
eggNOG 1 0.900 - - E1_KOG0767
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37649
Inparanoid 1 1.050 510 1.000 Inparanoid score I1327
Isobase 1 0.950 - 0.834419 Normalized mean entropy S396
OMA 1 1.010 - - QHG55239
OrthoDB 1 1.010 - - D423866at33208
OrthoFinder 1 1.000 - - FOG0001887
OrthoInspector 1 1.000 - - otm40449
orthoMCL 1 0.900 - - OOG6_101022
Panther 1 1.100 - - O PTHR45671
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2231
SonicParanoid 1 1.000 - - X1083
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1716.750

Return to query results.
Submit another query.