DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and CG7943

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_651766.1 Gene:CG7943 / 43574 FlyBaseID:FBgn0039741 Length:332 Species:Drosophila melanogaster


Alignment Length:331 Identity:68/331 - (20%)
Similarity:112/331 - (33%) Gaps:92/331 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    69 FGSNHY-FLLCGLGGIISCGSTHTMVV---PLDLVKCRLQVDPAKYKSVF---------TGFRIS 120
            |||..: ...||      ||:....:.   |:             ||.:|         |.....
  Fly    49 FGSFQWEEFACG------CGAAFVNIAVTYPI-------------YKMIFRQMLHGVPITSAFAQ 94

  Fly   121 LAEEGVRGLAKGWAPTFIGYSMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLY----LAASAS 181
            |..||:..|.:|..|.....::.....||:::..::.    :.|:    ||...|    |||..:
  Fly    95 LRHEGLGFLYRGMLPPLAQKTISLSIMFGVFDGTRRY----LVED----YRLNDYGAKVLAAVVA 151

  Fly   182 AEFFADIALAPMEAAKVKIQTTPGFAK------TLREALPKMTAQEGVTAFYKGLVPLWMRQIPY 240
            ..  |:..|.|.|    ::||....:|      ..:.|...:.:..|....|:||.|::.|....
  Fly   152 GS--AESILLPFE----RVQTLLADSKFHQHFSNTQNAFRYVVSHHGYRELYRGLEPVFWRNGLS 210

  Fly   241 TMMKFACFERTLELLYKYVVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAK 305
            ..:.|...|.....|     ||.::..|:   .|..|.||.:.|...:.:.:|.:.:...|....
  Fly   211 NALFFVLREEASVRL-----PKRKSVSTR---TVQEFIAGAVIGASISTIFYPLNVIKVSLQSEM 267

  Fly   306 GASALDVAKQLGWSGLWGG----LVPRIVMIGTL----------TAAQWFI----YDAVKVFLRM 352
            |..:         .|.|..    .|.|...||..          :...|.|    |:.:|..::.
  Fly   268 GQRS---------EGSWQACKRIYVERDRRIGNFYRGCPFNTGRSFISWGIMNTAYENLKKLMQQ 323

  Fly   353 PRPPPP 358
             :||.|
  Fly   324 -QPPLP 328

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 18/101 (18%)
Mito_carr <188..258 CDD:278578 16/75 (21%)
Mito_carr 273..350 CDD:278578 18/94 (19%)
CG7943NP_651766.1 Mito_carr 54..136 CDD:278578 18/108 (17%)
Mito_carr 141..229 CDD:278578 23/98 (23%)
Mito_carr 235..322 CDD:278578 18/95 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441815
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.