DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mpcp1 and CG5805

DIOPT Version :9

Sequence 1:NP_001286628.1 Gene:Mpcp1 / 37297 FlyBaseID:FBgn0034497 Length:374 Species:Drosophila melanogaster
Sequence 2:NP_001287513.1 Gene:CG5805 / 42950 FlyBaseID:FBgn0039223 Length:339 Species:Drosophila melanogaster


Alignment Length:300 Identity:63/300 - (21%)
Similarity:119/300 - (39%) Gaps:56/300 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 IISCGSTHTMVVPLDLVKCRLQVDPAKYKS-VFTGFRISLA-----EEGVRGLAKG-WAPTFIGY 140
            ::|..|....:.||.::|.:|||   ::|| |:.|. :..|     .|||.||.:| |..:.  .
  Fly    47 MLSSFSVRCCLFPLTVIKTQLQV---QHKSDVYKGM-VDCAMKIYRSEGVPGLYRGFWISSV--Q 105

  Fly   141 SMQGLCKFGLYEVFKKVYGDAIGEENAFLYRTGLYLAASASAEFFADIALAPMEAAK-------- 197
            .:.|:.....||..:.|..| :|..:..     ..||....|.......:.|.:...        
  Fly   106 IVSGVFYISTYEGVRHVLND
-LGAGHRM-----KALAGGGCASLVGQTIIVPFDVISQHAMVLGM 164

  Fly   198 ------------VKIQTTPGFAKTLREALP---KMTAQEGVTAFYKGLVPLWMRQIPYTMMKFAC 247
                        :.|::.||.:: |..::.   ::..::|...||:|.....|..:|.:.|.:|.
  Fly   165 SAHAGSKGDINPLGIKSWPGRSR-LHISMDIGREIMRRDGFRGFYRGYTASLMAYVPNSAMWWAF 228

  Fly   248 FERTLELLYKYVVPKPRADCTKGEQLVVTFAAGYIAGVFCAIVSHPADTVVSKLNQAKGASALDV 312
            :....:.|:: :.|      .....|.:...||.:.|....|:::|.|.|.::| |.....::.|
  Fly   229 YHLYQDELFR
-ICP------VWVSHLFIQCVAGSLGGFTTTILTNPLDIVRARL-QVHRLDSMSV 285

  Fly   313 AKQLGW-----SGLWGGLVPRIVMIGTLTAAQWFIYDAVK 347
            |.:..|     :..:.||..|:|.....:.:....|:.:|
  Fly   286 AFRELWQEEKLNCFFKGLSARLVQSAAFSFSIILGYETIK 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mpcp1NP_001286628.1 Mito_carr 71..160 CDD:278578 24/83 (29%)
Mito_carr <188..258 CDD:278578 14/92 (15%)
Mito_carr 273..350 CDD:278578 18/79 (23%)
CG5805NP_001287513.1 Mito_carr 46..125 CDD:395101 24/83 (29%)
Mito_carr 132..238 CDD:395101 17/111 (15%)
Mito_carr 245..327 CDD:395101 18/81 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45441529
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.